Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1561
Gene name
LocationContig_166:1959..3457
Strand-
Gene length (bp)1498
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 2.4E-18 47 179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 27 210 9.0E-19
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 37 290 6.0E-14
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 47 295 3.0E-13
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 29 248 3.0E-11
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 47 238 8.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 27 210 9.0E-19
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 37 290 6.0E-14
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 47 295 3.0E-13
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 29 248 3.0E-11
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 47 238 8.0E-10
sp|Q9FZC7|FOX4_ARATH Flavin-dependent oxidoreductase FOX4 OS=Arabidopsis thaliana GN=FOX4 PE=2 SV=1 8 290 1.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0016491 oxidoreductase activity Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1561
MKAGALTQLLRDLRRRTGPDVEVLADPSDDGFRHHARRWSDLDRRIPAAIVLPETEAQIQVVVRWAVEWAVPFVV
KSGGHSNWSTCDGIVIDLSKYSGLEVEVSNRTAKLRGSILTKEVAVGLAETGHFTALGNGNTVGAIPYFLNGGAS
ITNSLTGYGSDQILSARMVDARGRMVEVSREKTPGLFYAIRGAGQFFGLITELTVRIWPLSELGKQGTLWSGRFV
YPLDRAREVAQAMELVVNDSKWATAGLVMAICPPPARKPALVVAARFRGDTDQAELAFEPLHELGPLMADGGPVA
IQNICDGREALEAKGGYKTFGTVGLKCFDVDRFLGTIDVWKRLMDECPDAINTTFNFQWDSRPPPEPEHDSANCL
HDVRFWQNNIIWYTEASSGERVAQLNAECIAVARGFDEADCIDFANATREGALERRFRGEGRLERLRALKIGWDA
GGVFTRQFLD*
Coding >Ophun1|1561
ATGAAAGCCGGTGCCTTGACTCAGCTGCTTCGAGACCTGCGGCGTCGGACGGGCCCCGATGTCGAGGTGCTTGCC
GACCCGAGCGATGATGGTTTCAGACATCACGCCAGGCGCTGGTCCGACCTCGACAGACGGATTCCTGCAGCCATC
GTGCTGCCCGAGACGGAGGCCCAGATACAGGTCGTGGTGCGATGGGCGGTTGAGTGGGCGGTGCCGTTCGTCGTC
AAGTCTGGCGGGCACAGCAACTGGTCTACTTGCGATGGTATCGTTATCGACCTCAGCAAGTACTCGGGCTTGGAG
GTTGAAGTGTCGAACAGGACTGCCAAGCTGCGAGGCAGTATCCTGACCAAGGAGGTGGCAGTTGGGCTGGCCGAG
ACGGGACATTTCACGGCGCTCGGGAACGGAAACACGGTCGGGGCCATCCCTTACTTTCTCAACGGCGGCGCCTCC
ATCACCAACTCCCTCACCGGCTACGGCTCTGACCAGATCCTGTCCGCTCGCATGGTGGACGCCAGAGGTAGGATG
GTGGAGGTGTCGCGGGAGAAGACGCCTGGCCTGTTCTACGCCATACGCGGGGCTGGTCAGTTCTTTGGCCTGATT
ACCGAGCTCACCGTCCGGATCTGGCCTCTGAGCGAGCTCGGGAAGCAGGGGACTCTCTGGTCCGGCCGGTTCGTG
TACCCGCTGGACAGGGCGAGGGAGGTCGCACAGGCGATGGAGCTGGTCGTCAACGACAGCAAGTGGGCGACAGCA
GGACTCGTCATGGCCATTTGCCCGCCGCCTGCCCGGAAGCCAGCGCTGGTGGTGGCGGCGAGGTTCAGGGGAGAC
ACGGACCAAGCGGAGCTCGCCTTTGAGCCTCTGCACGAATTGGGGCCGCTGATGGCGGACGGGGGGCCCGTTGCC
ATCCAGAACATCTGTGACGGTCGTGAGGCGCTCGAAGCCAAGGGCGGTTACAAGACGTTTGGGACCGTGGGACTG
AAGTGTTTCGACGTGGACCGCTTTCTGGGGACGATTGACGTGTGGAAGCGTCTGATGGACGAGTGTCCCGATGCC
ATCAACACTACGTTTAACTTTCAGTGGGATTCGAGGCCGCCTCCGGAGCCCGAGCATGATTCGGCCAATTGTCTT
CACGATGTTCGGTTCTGGCAAAACAACATCATCTGGTACACGGAAGCCAGCAGCGGCGAGAGGGTGGCGCAGCTC
AATGCCGAATGCATCGCCGTCGCGCGCGGGTTTGACGAGGCTGACTGTATCGACTTTGCCAACGCAACGAGAGAG
GGGGCTTTGGAGAGGCGCTTCCGGGGCGAGGGGAGGCTGGAGAGGTTGAGGGCTTTGAAGATTGGGTGGGATGCA
GGTGGGGTTTTTACGCGGCAGTTTCTTGACTGA
Transcript >Ophun1|1561
ATGAAAGCCGGTGCCTTGACTCAGCTGCTTCGAGACCTGCGGCGTCGGACGGGCCCCGATGTCGAGGTGCTTGCC
GACCCGAGCGATGATGGTTTCAGACATCACGCCAGGCGCTGGTCCGACCTCGACAGACGGATTCCTGCAGCCATC
GTGCTGCCCGAGACGGAGGCCCAGATACAGGTCGTGGTGCGATGGGCGGTTGAGTGGGCGGTGCCGTTCGTCGTC
AAGTCTGGCGGGCACAGCAACTGGTCTACTTGCGATGGTATCGTTATCGACCTCAGCAAGTACTCGGGCTTGGAG
GTTGAAGTGTCGAACAGGACTGCCAAGCTGCGAGGCAGTATCCTGACCAAGGAGGTGGCAGTTGGGCTGGCCGAG
ACGGGACATTTCACGGCGCTCGGGAACGGAAACACGGTCGGGGCCATCCCTTACTTTCTCAACGGCGGCGCCTCC
ATCACCAACTCCCTCACCGGCTACGGCTCTGACCAGATCCTGTCCGCTCGCATGGTGGACGCCAGAGGTAGGATG
GTGGAGGTGTCGCGGGAGAAGACGCCTGGCCTGTTCTACGCCATACGCGGGGCTGGTCAGTTCTTTGGCCTGATT
ACCGAGCTCACCGTCCGGATCTGGCCTCTGAGCGAGCTCGGGAAGCAGGGGACTCTCTGGTCCGGCCGGTTCGTG
TACCCGCTGGACAGGGCGAGGGAGGTCGCACAGGCGATGGAGCTGGTCGTCAACGACAGCAAGTGGGCGACAGCA
GGACTCGTCATGGCCATTTGCCCGCCGCCTGCCCGGAAGCCAGCGCTGGTGGTGGCGGCGAGGTTCAGGGGAGAC
ACGGACCAAGCGGAGCTCGCCTTTGAGCCTCTGCACGAATTGGGGCCGCTGATGGCGGACGGGGGGCCCGTTGCC
ATCCAGAACATCTGTGACGGTCGTGAGGCGCTCGAAGCCAAGGGCGGTTACAAGACGTTTGGGACCGTGGGACTG
AAGTGTTTCGACGTGGACCGCTTTCTGGGGACGATTGACGTGTGGAAGCGTCTGATGGACGAGTGTCCCGATGCC
ATCAACACTACGTTTAACTTTCAGTGGGATTCGAGGCCGCCTCCGGAGCCCGAGCATGATTCGGCCAATTGTCTT
CACGATGTTCGGTTCTGGCAAAACAACATCATCTGGTACACGGAAGCCAGCAGCGGCGAGAGGGTGGCGCAGCTC
AATGCCGAATGCATCGCCGTCGCGCGCGGGTTTGACGAGGCTGACTGTATCGACTTTGCCAACGCAACGAGAGAG
GGGGCTTTGGAGAGGCGCTTCCGGGGCGAGGGGAGGCTGGAGAGGTTGAGGGCTTTGAAGATTGGGTGGGATGCA
GGTGGGGTTTTTACGCGGCAGTTTCTTGACTGA
Gene >Ophun1|1561
ATGAAAGCCGGTGCCTTGACTCAGCTGCTTCGAGACCTGCGGCGTCGGACGGGCCCCGATGTCGAGGTGCTTGCC
GACCCGAGCGATGATGGTTTCAGACATCACGCCAGGCGCTGGTCCGACCTCGACAGACGGATTCCTGCAGCCATC
GTGCTGCCCGAGACGGAGGCCCAGATACAGGTCGTGGTGAGTCGATTGTCCGCCGACGGGGCAGTCTGATGTTGT
GGCTGACGGGGGGGGGGGCCTCCAGGTGCGATGGGCGGTTGAGTGGGCGGTGCCGTTCGTCGTCAAGTCTGGCGG
GCACAGCAACTGGTCTACTTGCGATGGTATCGTTATCGACCTCAGCAAGTACTCGGGCTTGGAGGTTGAAGTGTC
GAACAGGACTGCCAAGCTGCGAGGCAGTATCCTGACCAAGGAGGTGGCAGTTGGGCTGGCCGAGACGGGACATTT
CACGGCGCTCGGGAACGGAAACACGGTCGGGGCCATCCCTTACTTTCTCAACGGCGGCGCCTCCATCACCAACTC
CCTCACCGGCTACGGCTCTGACCAGATCCTGTCCGCTCGCATGGTGGACGCCAGAGGTAGGATGGTGGAGGTGTC
GCGGGAGAAGACGCCTGGCCTGTTCTACGCCATACGCGGGGCTGGTCAGTTCTTTGGCCTGATTACCGAGCTCAC
CGTCCGGATCTGGCCTCTGAGCGAGCTCGGGAAGCAGGGGACTCTCTGGTCCGGCCGGTTCGTGTACCCGCTGGA
CAGGGCGAGGGAGGTCGCACAGGCGATGGAGCTGGTCGTCAACGACAGCAAGTGGGCGACAGCAGGACTCGTCAT
GGCCATTTGCCCGCCGCCTGCCCGGAAGCCAGCGCTGGTGGTGGCGGCGAGGTTCAGGGGAGACACGGACCAAGC
GGAGCTCGCCTTTGAGCCTCTGCACGAATTGGGGCCGCTGATGGCGGACGGGGGGCCCGTTGCCATCCAGAACAT
CTGTGACGGTCGTGAGGCGCTCGAAGCCAAGGGCGGTTACAAGACGTTTGGGACCGTGGGACTGAAGTGTTTCGA
CGTGGACCGCTTTCTGGGGACGATTGACGTGTGGAAGCGTCTGATGGACGAGTGTCCCGATGCCATCAACACTAC
GTTTAACTTTCAGTGGGATTCGAGGCCGCCTCCGGAGCCCGAGCATGATTCGGCCAATTGTCTTCACGATGTTCG
GTTCTGGCAGTAGGTTACAATCCGCAGCGAGAACCATCCGCCGTACTGACCGAGACGCAGAAACAACATCATCTG
GTACACGGAAGCCAGCAGCGGCGAGAGGGTGGCGCAGCTCAATGCCGAATGCATCGCCGTCGCGCGCGGGTTTGA
CGAGGCTGACTGTATCGACTTTGCCAACGCAACGAGAGAGGGGGCTTTGGAGAGGCGCTTCCGGGGCGAGGGGAG
GCTGGAGAGGTTGAGGGCTTTGAAGATTGGGTGGGATGCAGGTGGGGTTTTTACGCGGCAGTTTCTTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail