Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1560
Gene name
LocationContig_166:689..1898
Strand+
Gene length (bp)1209
Transcript length (bp)1209
Coding sequence length (bp)1209
Protein length (aa) 403

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 5.9E-06 322 359

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Y1|A2462_ARTBC Probable FAD-dependent monooxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02462 PE=3 SV=1 2 174 5.0E-16
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 2 353 7.0E-10
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 4 185 5.0E-09
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 4 185 5.0E-08
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 4 185 9.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4B1Y1|A2462_ARTBC Probable FAD-dependent monooxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02462 PE=3 SV=1 2 174 5.0E-16
sp|Q0JCU7|ZEP_ORYSJ Zeaxanthin epoxidase, chloroplastic OS=Oryza sativa subsp. japonica GN=ZEP PE=2 SV=1 2 353 7.0E-10
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 4 185 5.0E-09
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 4 185 5.0E-08
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 4 185 9.0E-07
sp|Q96375|ABA2_CAPAN Zeaxanthin epoxidase, chloroplastic OS=Capsicum annuum PE=2 SV=1 4 185 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1560
MPPILIIGAGIGGLTLAQHLSTHSIPFEIYERDPSLTSRLQGFRLKIPPETSARLQQAITPLAWETLVRTSAACE
AGETNLNAVDGSVSACRRERLPPGVEAPLAVDRGLLRLALAEGIVQHVFFGKRLVSWQLVGDDAVKASFQDGSSV
LGSLLVGADGARSVIRRGLLPGSEPSDTSICCIYGKTTLDAVLEARFPEHHRRWLTVVHDQTPAIQSIIARRTTP
ITMVCEPCRFSNRDTYKHLPADYVHFGILFPRSLLGSHLSDHDVDGMLRDQAPELALEVTSEWHPSIRSLIELQS
CQLTSGMRVFSAPVQIPVWDGSGRVTMIGDAVHLMSPAGGVGATATLEDAILLGSVISEKGISRASISSFEQRMR
ESAAGYIRRSLLAGNRFLDLPYNEETS*
Coding >Ophun1|1560
ATGCCCCCAATCCTCATCATCGGCGCCGGAATAGGCGGCCTCACCCTCGCCCAGCACCTCTCAACTCACTCCATC
CCCTTCGAAATCTACGAGCGCGACCCATCCCTCACCTCCCGCCTTCAGGGCTTCCGCCTCAAGATCCCCCCCGAA
ACATCCGCCAGACTGCAACAGGCCATCACGCCGCTCGCCTGGGAAACCCTCGTCCGCACCAGCGCCGCCTGCGAA
GCCGGCGAGACGAACCTCAACGCCGTCGACGGCTCCGTCTCGGCCTGTCGGAGGGAGAGGCTTCCTCCGGGGGTG
GAGGCTCCGCTTGCTGTGGATAGGGGCTTGTTGCGGTTGGCGTTGGCTGAGGGGATCGTCCAGCATGTTTTCTTT
GGGAAGAGGCTTGTTTCGTGGCAACTTGTCGGCGACGATGCCGTCAAAGCCAGCTTCCAGGATGGATCCTCCGTC
CTCGGCTCACTCCTCGTAGGCGCAGACGGAGCCCGGTCCGTGATCCGGCGCGGCCTCCTCCCCGGCTCCGAACCC
TCCGACACCTCGATATGCTGCATCTACGGCAAGACAACCCTCGACGCCGTACTGGAAGCCCGCTTCCCCGAGCAT
CACCGTCGATGGCTCACCGTCGTCCACGACCAAACACCCGCCATCCAATCCATCATCGCCAGAAGAACAACCCCC
ATCACAATGGTCTGCGAGCCCTGCCGCTTCTCAAACCGGGATACGTACAAGCACCTCCCTGCGGATTACGTCCAT
TTCGGCATCCTCTTCCCGAGATCCCTGCTTGGCTCTCACCTTTCTGACCATGACGTCGATGGCATGCTGAGGGAC
CAGGCGCCAGAGTTGGCCCTGGAAGTGACCAGCGAATGGCATCCCTCCATCCGGTCCCTCATCGAGCTGCAGAGC
TGCCAGCTCACCTCTGGGATGCGCGTCTTCTCTGCCCCGGTGCAGATCCCCGTCTGGGATGGAAGCGGTCGGGTG
ACGATGATCGGGGACGCCGTCCACCTCATGTCACCGGCTGGGGGCGTAGGAGCTACGGCTACCCTCGAGGATGCC
ATCTTGCTAGGGAGCGTCATCTCAGAGAAGGGCATCTCGCGGGCGTCTATCTCGAGCTTCGAGCAGAGAATGAGG
GAGTCGGCGGCGGGATACATCCGTCGGAGTCTTTTAGCCGGCAACAGGTTCCTCGACTTGCCTTATAACGAGGAA
ACGTCATGA
Transcript >Ophun1|1560
ATGCCCCCAATCCTCATCATCGGCGCCGGAATAGGCGGCCTCACCCTCGCCCAGCACCTCTCAACTCACTCCATC
CCCTTCGAAATCTACGAGCGCGACCCATCCCTCACCTCCCGCCTTCAGGGCTTCCGCCTCAAGATCCCCCCCGAA
ACATCCGCCAGACTGCAACAGGCCATCACGCCGCTCGCCTGGGAAACCCTCGTCCGCACCAGCGCCGCCTGCGAA
GCCGGCGAGACGAACCTCAACGCCGTCGACGGCTCCGTCTCGGCCTGTCGGAGGGAGAGGCTTCCTCCGGGGGTG
GAGGCTCCGCTTGCTGTGGATAGGGGCTTGTTGCGGTTGGCGTTGGCTGAGGGGATCGTCCAGCATGTTTTCTTT
GGGAAGAGGCTTGTTTCGTGGCAACTTGTCGGCGACGATGCCGTCAAAGCCAGCTTCCAGGATGGATCCTCCGTC
CTCGGCTCACTCCTCGTAGGCGCAGACGGAGCCCGGTCCGTGATCCGGCGCGGCCTCCTCCCCGGCTCCGAACCC
TCCGACACCTCGATATGCTGCATCTACGGCAAGACAACCCTCGACGCCGTACTGGAAGCCCGCTTCCCCGAGCAT
CACCGTCGATGGCTCACCGTCGTCCACGACCAAACACCCGCCATCCAATCCATCATCGCCAGAAGAACAACCCCC
ATCACAATGGTCTGCGAGCCCTGCCGCTTCTCAAACCGGGATACGTACAAGCACCTCCCTGCGGATTACGTCCAT
TTCGGCATCCTCTTCCCGAGATCCCTGCTTGGCTCTCACCTTTCTGACCATGACGTCGATGGCATGCTGAGGGAC
CAGGCGCCAGAGTTGGCCCTGGAAGTGACCAGCGAATGGCATCCCTCCATCCGGTCCCTCATCGAGCTGCAGAGC
TGCCAGCTCACCTCTGGGATGCGCGTCTTCTCTGCCCCGGTGCAGATCCCCGTCTGGGATGGAAGCGGTCGGGTG
ACGATGATCGGGGACGCCGTCCACCTCATGTCACCGGCTGGGGGCGTAGGAGCTACGGCTACCCTCGAGGATGCC
ATCTTGCTAGGGAGCGTCATCTCAGAGAAGGGCATCTCGCGGGCGTCTATCTCGAGCTTCGAGCAGAGAATGAGG
GAGTCGGCGGCGGGATACATCCGTCGGAGTCTTTTAGCCGGCAACAGGTTCCTCGACTTGCCTTATAACGAGGAA
ACGTCATGA
Gene >Ophun1|1560
ATGCCCCCAATCCTCATCATCGGCGCCGGAATAGGCGGCCTCACCCTCGCCCAGCACCTCTCAACTCACTCCATC
CCCTTCGAAATCTACGAGCGCGACCCATCCCTCACCTCCCGCCTTCAGGGCTTCCGCCTCAAGATCCCCCCCGAA
ACATCCGCCAGACTGCAACAGGCCATCACGCCGCTCGCCTGGGAAACCCTCGTCCGCACCAGCGCCGCCTGCGAA
GCCGGCGAGACGAACCTCAACGCCGTCGACGGCTCCGTCTCGGCCTGTCGGAGGGAGAGGCTTCCTCCGGGGGTG
GAGGCTCCGCTTGCTGTGGATAGGGGCTTGTTGCGGTTGGCGTTGGCTGAGGGGATCGTCCAGCATGTTTTCTTT
GGGAAGAGGCTTGTTTCGTGGCAACTTGTCGGCGACGATGCCGTCAAAGCCAGCTTCCAGGATGGATCCTCCGTC
CTCGGCTCACTCCTCGTAGGCGCAGACGGAGCCCGGTCCGTGATCCGGCGCGGCCTCCTCCCCGGCTCCGAACCC
TCCGACACCTCGATATGCTGCATCTACGGCAAGACAACCCTCGACGCCGTACTGGAAGCCCGCTTCCCCGAGCAT
CACCGTCGATGGCTCACCGTCGTCCACGACCAAACACCCGCCATCCAATCCATCATCGCCAGAAGAACAACCCCC
ATCACAATGGTCTGCGAGCCCTGCCGCTTCTCAAACCGGGATACGTACAAGCACCTCCCTGCGGATTACGTCCAT
TTCGGCATCCTCTTCCCGAGATCCCTGCTTGGCTCTCACCTTTCTGACCATGACGTCGATGGCATGCTGAGGGAC
CAGGCGCCAGAGTTGGCCCTGGAAGTGACCAGCGAATGGCATCCCTCCATCCGGTCCCTCATCGAGCTGCAGAGC
TGCCAGCTCACCTCTGGGATGCGCGTCTTCTCTGCCCCGGTGCAGATCCCCGTCTGGGATGGAAGCGGTCGGGTG
ACGATGATCGGGGACGCCGTCCACCTCATGTCACCGGCTGGGGGCGTAGGAGCTACGGCTACCCTCGAGGATGCC
ATCTTGCTAGGGAGCGTCATCTCAGAGAAGGGCATCTCGCGGGCGTCTATCTCGAGCTTCGAGCAGAGAATGAGG
GAGTCGGCGGCGGGATACATCCGTCGGAGTCTTTTAGCCGGCAACAGGTTCCTCGACTTGCCTTATAACGAGGAA
ACGTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail