Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1555
Gene name
LocationContig_165:13812..16826
Strand-
Gene length (bp)3014
Transcript length (bp)2958
Coding sequence length (bp)2958
Protein length (aa) 986

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09427 DUF2014 Domain of unknown function (DUF2014) 4.3E-100 564 814
PF00010 HLH Helix-loop-helix DNA-binding domain 2.0E-17 217 291

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 180 323 2.0E-26
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 217 317 1.0E-19
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 214 301 1.0E-19
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 218 293 1.0E-15
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 429 773 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 180 323 2.0E-26
sp|O43019|SRE2_SCHPO Putative transcription factor sre2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre2 PE=1 SV=1 217 317 1.0E-19
sp|Q59RL7|CPH2_CANAL Transcription factor CPH2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CPH2 PE=1 SV=1 214 301 1.0E-19
sp|Q12398|HMS1_YEAST Probable transcription factor HMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMS1 PE=1 SV=1 218 293 1.0E-15
sp|Q9UUD1|SREBP_SCHPO Sterol regulatory element-binding protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sre1 PE=1 SV=1 429 773 2.0E-10
sp|Q5AL36|TYE7_CANAL Carbohydrate metabolism regulator TYE7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TYE7 PE=1 SV=1 217 308 2.0E-10
sp|Q60416|SRBP1_CRIGR Sterol regulatory element-binding protein 1 OS=Cricetulus griseus GN=SREBF1 PE=2 SV=1 217 305 3.0E-09
sp|O97676|SRBP1_PIG Sterol regulatory element-binding protein 1 OS=Sus scrofa GN=SREBF1 PE=2 SV=2 217 305 5.0E-09
sp|P36956|SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens GN=SREBF1 PE=1 SV=2 217 308 6.0E-09
sp|P56720|SRBP1_RAT Sterol regulatory element-binding protein 1 OS=Rattus norvegicus GN=Srebf1 PE=1 SV=3 217 305 9.0E-09
sp|Q9WTN3|SRBP1_MOUSE Sterol regulatory element-binding protein 1 OS=Mus musculus GN=Srebf1 PE=1 SV=4 217 305 1.0E-08
sp|A3KNA7|SRBP2_DANRE Sterol regulatory element-binding protein 2 OS=Danio rerio GN=srebf2 PE=2 SV=1 209 305 2.0E-08
sp|Q6GQ26|SRBP2_XENLA Sterol regulatory element-binding protein 2 OS=Xenopus laevis GN=srebf2 PE=2 SV=1 217 305 2.0E-08
sp|Q3U1N2|SRBP2_MOUSE Sterol regulatory element-binding protein 2 OS=Mus musculus GN=Srebf2 PE=1 SV=2 217 305 6.0E-08
sp|Q12772|SRBP2_HUMAN Sterol regulatory element-binding protein 2 OS=Homo sapiens GN=SREBF2 PE=1 SV=2 217 305 6.0E-08
sp|Q60429|SRBP2_CRIGR Sterol regulatory element-binding protein 2 OS=Cricetulus griseus GN=SREBF2 PE=2 SV=1 217 305 6.0E-08
sp|Q3T1I5|SRBP2_RAT Sterol regulatory element-binding protein 2 OS=Rattus norvegicus GN=Srebf2 PE=2 SV=1 217 305 7.0E-08
sp|P33122|TYE7_YEAST Serine-rich protein TYE7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYE7 PE=1 SV=1 215 297 3.0E-07
sp|P52162|MAX_CHICK Protein max OS=Gallus gallus GN=MAX PE=3 SV=1 205 313 7.0E-06
sp|P61244|MAX_HUMAN Protein max OS=Homo sapiens GN=MAX PE=1 SV=1 205 313 9.0E-06
sp|P61245|MAX_FELCA Protein max OS=Felis catus GN=MAX PE=2 SV=1 205 313 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032933 SREBP signaling pathway Yes
GO:0045944 positive regulation of transcription by RNA polymerase II Yes
GO:0046983 protein dimerization activity Yes
GO:0006991 response to sterol depletion No
GO:1902680 positive regulation of RNA biosynthetic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0051252 regulation of RNA metabolic process No
GO:0051173 positive regulation of nitrogen compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0019222 regulation of metabolic process No
GO:0031328 positive regulation of cellular biosynthetic process No
GO:0050896 response to stimulus No
GO:0045893 positive regulation of transcription, DNA-templated No
GO:2001141 regulation of RNA biosynthetic process No
GO:0031325 positive regulation of cellular metabolic process No
GO:0010468 regulation of gene expression No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010557 positive regulation of macromolecule biosynthetic process No
GO:0007165 signal transduction No
GO:0048518 positive regulation of biological process No
GO:0009889 regulation of biosynthetic process No
GO:0071501 cellular response to sterol depletion No
GO:0009987 cellular process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0006357 regulation of transcription by RNA polymerase II No
GO:0031326 regulation of cellular biosynthetic process No
GO:0050789 regulation of biological process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0006984 ER-nucleus signaling pathway No
GO:0006950 response to stress No
GO:0048522 positive regulation of cellular process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0009893 positive regulation of metabolic process No
GO:0045935 positive regulation of nucleobase-containing compound metabolic process No
GO:0010604 positive regulation of macromolecule metabolic process No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0009891 positive regulation of biosynthetic process No
GO:0033554 cellular response to stress No
GO:0051254 positive regulation of RNA metabolic process No
GO:1903508 positive regulation of nucleic acid-templated transcription No
GO:0006355 regulation of transcription, DNA-templated No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Helix-loop-helix

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3070
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|146
Ophiocordyceps australis map64 (Brazil) OphauB2|499
Ophiocordyceps camponoti-floridani Ophcf2|01222
Ophiocordyceps camponoti-rufipedis Ophun1|1555 (this protein)
Ophiocordyceps kimflemingae Ophio5|713
Ophiocordyceps subramaniannii Hirsu2|5329

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1555
MADDESAGRFGLDEPVFGFMGDATAMPAANSDPPPASTDNTQTFYGPSSWDFQVNTPFDSFDVASSSATPTVSTG
GSVGPPWPLPSFDQTQQQRQQPVQAASPSFDGFSTSRVNPKTVFSSNPSLTSGSTTTAKAAQVRAASGMSHEELR
NIAMPPHLHYNSPKSASSPDSANSEAKIGAASSPELLGLSKKDSRKRKASDELEDDDEVEDGDKPVKKTAHNMIE
KRYRTNINDKIAALRDSVPSLRIMSKSARGEDTTEDREELHGLTPAHKLNKATVLSKATEYIRHLEKRNSRLTDE
NNAMKERIGAFEKLFMAGAMNGSISPMQHPPTPMSYPQESQQQFTSSPMATPQDSSSNPAGMINVPEDMKRIISA
QMAAGQPYPVPSQPFRGGNPAVVRQQQMQQQQQQQQQPQQQMQRNGWVNASPYLGKLMVGSLAGLMILEGLGEDE
KSNEEPQGRGLFALPVQFLGRLSSALDLHVMGYHVHTSLRLLLIMGAFLWIFIPMLFSSPDTKLGKGQRAALLKR
APSLASSIDVRRQAWLTAIQTVWVPRHNFFLEASALMLKALKLSLRNAIGGQAYQMLTGLSEEEEAARVKAWSIA
LDSQLAGGDAGICKSRLILTLLASGTLPDTPARLMLRALHIRVLLWEFSKSNRLLGAIDAVAAKLARKQWNEARH
QNRLLQVRTRRGSRTALENHLPDHLVALVEQESDDVLSASVIQRAHNLAFNVDTASSIESRIDGMDAVVDDIAVG
SPMDAVAAWWSTQLLHRVLTATLDEDSQALRSKGEDITLAIKAAPTGSVARIRAVLARAVLVEGCGPQDTDLARR
AIAKGEVNSSLGSPSLIGGPVAHAPDGDLTISLKCATAIAHFRQAPSASGRLDLLQGIAKVEHMPSMTLLGFTAM
MELMKHLLGQEGLRHEFDLTLSRLSSGLRLWMGRPWASRCGVSSELRNKLVEKCLAATKSLAWPDMDSGCGSLSD
SDDMNTCART*
Coding >Ophun1|1555
ATGGCCGACGACGAGTCTGCCGGCCGCTTCGGCCTCGACGAGCCCGTCTTCGGCTTCATGGGCGATGCCACTGCC
ATGCCCGCCGCCAACTCGGACCCTCCTCCCGCCTCTACCGATAATACTCAGACCTTTTACGGCCCCTCATCCTGG
GACTTCCAGGTAAACACCCCCTTCGACTCCTTCGACGTCGCCTCTTCCAGCGCGACTCCCACCGTCTCGACCGGA
GGCTCCGTCGGCCCGCCCTGGCCGCTCCCCTCCTTCGACCAGACCCAGCAGCAGCGCCAACAGCCGGTCCAGGCC
GCGTCTCCTTCCTTCGACGGCTTCTCGACGTCCCGCGTCAACCCCAAGACCGTCTTCAGCTCCAACCCATCCCTC
ACGTCCGGCTCTACCACGACGGCCAAGGCTGCTCAGGTCCGTGCGGCCTCTGGAATGTCTCACGAAGAGCTTCGA
AACATCGCCATGCCGCCTCATCTCCATTACAACTCCCCCAAGAGCGCTTCCAGCCCCGACTCGGCCAACAGCGAG
GCCAAGATTGGCGCTGCCTCCTCCCCCGAGCTCCTTGGTCTGTCCAAAAAGGACTCCCGGAAGCGAAAGGCGTCC
GACGAGCTCGAGGACGACGACGAAGTGGAAGATGGAGACAAACCTGTCAAGAAGACGGCCCACAACATGATCGAG
AAGAGGTATCGCACCAACATCAACGACAAGATTGCCGCCCTGCGCGACAGCGTTCCCAGCTTGAGGATCATGTCC
AAGAGCGCCAGGGGCGAGGACACGACCGAGGACCGCGAGGAGCTTCACGGCCTGACGCCGGCGCACAAGCTGAAC
AAGGCAACCGTGCTGAGCAAGGCGACGGAATACATTCGGCATCTCGAGAAGCGAAACAGTCGTCTTACGGATGAG
AACAACGCCATGAAGGAAAGGATAGGGGCTTTCGAGAAGCTCTTCATGGCCGGAGCCATGAACGGCTCCATCAGT
CCCATGCAGCACCCGCCCACGCCCATGTCATACCCTCAGGAGAGCCAGCAGCAGTTTACCAGTTCGCCCATGGCC
ACTCCGCAAGACAGCAGCTCGAATCCTGCCGGCATGATCAATGTACCAGAGGACATGAAGCGCATCATCTCCGCC
CAGATGGCTGCTGGCCAACCGTACCCGGTACCTTCACAGCCTTTCCGAGGAGGCAATCCAGCCGTGGTGCGCCAG
CAGCAGATGCAGCAGCAGCAGCAACAGCAACAGCAGCCACAACAACAGATGCAACGGAATGGCTGGGTCAACGCG
AGTCCTTATCTCGGTAAACTCATGGTCGGCTCCCTTGCCGGCCTCATGATCCTCGAAGGCCTCGGAGAAGACGAG
AAAAGCAACGAAGAACCCCAGGGGAGGGGCCTCTTCGCTCTGCCTGTTCAATTCCTCGGCCGTCTGTCGTCGGCA
CTCGATCTTCACGTCATGGGATACCATGTCCACACCTCTCTCAGGTTATTGTTGATCATGGGTGCCTTTTTATGG
ATCTTCATCCCCATGCTCTTCTCATCGCCGGATACAAAACTCGGCAAGGGGCAGCGAGCTGCTCTCCTCAAGAGG
GCGCCGTCGCTCGCGTCTTCCATCGACGTGCGACGGCAGGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCC
AGACACAACTTCTTCCTCGAAGCCTCGGCCTTGATGCTCAAGGCACTCAAGCTCAGTCTGCGCAACGCAATCGGC
GGCCAGGCATATCAGATGTTGACGGGCCTGAGCGAGGAGGAGGAGGCGGCCCGGGTCAAGGCCTGGTCCATCGCC
CTCGACTCGCAGCTCGCGGGGGGGGACGCGGGCATCTGCAAGAGTCGCTTGATACTGACCCTGCTCGCTTCGGGC
ACCCTTCCCGACACCCCTGCTCGCCTGATGCTCAGGGCGCTCCACATCAGGGTCCTTCTGTGGGAGTTTAGCAAG
AGTAACAGGCTGCTGGGTGCCATCGACGCTGTGGCGGCGAAGCTTGCGAGGAAGCAATGGAACGAGGCGCGCCAT
CAGAATCGTCTCCTTCAGGTTCGGACGCGCCGCGGGTCTCGCACCGCTCTCGAGAACCATCTGCCGGACCACCTC
GTCGCCCTTGTCGAACAGGAGTCGGACGACGTTCTCAGCGCTTCCGTCATACAGAGGGCTCACAATCTCGCCTTT
AACGTGGACACGGCCAGCAGCATCGAGAGCCGCATCGACGGTATGGATGCCGTCGTCGACGACATCGCCGTGGGC
TCGCCTATGGACGCGGTCGCCGCCTGGTGGTCGACGCAACTCCTCCATCGCGTCCTGACGGCCACGTTGGACGAG
GACTCCCAGGCGCTGCGGAGCAAGGGCGAGGACATTACCCTGGCCATCAAAGCTGCGCCTACGGGATCCGTGGCC
CGGATCCGAGCCGTGTTGGCGCGTGCCGTCTTGGTCGAGGGATGCGGTCCCCAAGACACGGACCTGGCGCGCCGG
GCCATCGCCAAGGGGGAAGTGAACAGCTCTCTTGGCAGCCCGTCGCTGATAGGCGGGCCCGTCGCCCACGCGCCA
GATGGCGATCTGACAATCTCGCTCAAATGCGCGACGGCCATTGCTCACTTCAGACAGGCGCCGTCCGCCTCGGGC
CGGCTCGACCTCCTCCAGGGCATCGCCAAGGTGGAGCACATGCCGTCGATGACGCTGCTGGGTTTCACCGCCATG
ATGGAGTTGATGAAGCATCTTCTGGGCCAGGAGGGCCTGAGACACGAGTTTGATCTGACGCTGAGCAGGCTGTCG
AGCGGCCTCCGGCTATGGATGGGCAGACCATGGGCGTCGAGGTGCGGTGTCAGCTCTGAGCTTCGGAACAAGCTG
GTGGAGAAGTGTCTGGCGGCGACCAAGTCTCTGGCATGGCCGGACATGGACAGCGGGTGCGGCAGCCTGAGCGAC
AGCGATGACATGAACACTTGTGCGCGGACCTGA
Transcript >Ophun1|1555
ATGGCCGACGACGAGTCTGCCGGCCGCTTCGGCCTCGACGAGCCCGTCTTCGGCTTCATGGGCGATGCCACTGCC
ATGCCCGCCGCCAACTCGGACCCTCCTCCCGCCTCTACCGATAATACTCAGACCTTTTACGGCCCCTCATCCTGG
GACTTCCAGGTAAACACCCCCTTCGACTCCTTCGACGTCGCCTCTTCCAGCGCGACTCCCACCGTCTCGACCGGA
GGCTCCGTCGGCCCGCCCTGGCCGCTCCCCTCCTTCGACCAGACCCAGCAGCAGCGCCAACAGCCGGTCCAGGCC
GCGTCTCCTTCCTTCGACGGCTTCTCGACGTCCCGCGTCAACCCCAAGACCGTCTTCAGCTCCAACCCATCCCTC
ACGTCCGGCTCTACCACGACGGCCAAGGCTGCTCAGGTCCGTGCGGCCTCTGGAATGTCTCACGAAGAGCTTCGA
AACATCGCCATGCCGCCTCATCTCCATTACAACTCCCCCAAGAGCGCTTCCAGCCCCGACTCGGCCAACAGCGAG
GCCAAGATTGGCGCTGCCTCCTCCCCCGAGCTCCTTGGTCTGTCCAAAAAGGACTCCCGGAAGCGAAAGGCGTCC
GACGAGCTCGAGGACGACGACGAAGTGGAAGATGGAGACAAACCTGTCAAGAAGACGGCCCACAACATGATCGAG
AAGAGGTATCGCACCAACATCAACGACAAGATTGCCGCCCTGCGCGACAGCGTTCCCAGCTTGAGGATCATGTCC
AAGAGCGCCAGGGGCGAGGACACGACCGAGGACCGCGAGGAGCTTCACGGCCTGACGCCGGCGCACAAGCTGAAC
AAGGCAACCGTGCTGAGCAAGGCGACGGAATACATTCGGCATCTCGAGAAGCGAAACAGTCGTCTTACGGATGAG
AACAACGCCATGAAGGAAAGGATAGGGGCTTTCGAGAAGCTCTTCATGGCCGGAGCCATGAACGGCTCCATCAGT
CCCATGCAGCACCCGCCCACGCCCATGTCATACCCTCAGGAGAGCCAGCAGCAGTTTACCAGTTCGCCCATGGCC
ACTCCGCAAGACAGCAGCTCGAATCCTGCCGGCATGATCAATGTACCAGAGGACATGAAGCGCATCATCTCCGCC
CAGATGGCTGCTGGCCAACCGTACCCGGTACCTTCACAGCCTTTCCGAGGAGGCAATCCAGCCGTGGTGCGCCAG
CAGCAGATGCAGCAGCAGCAGCAACAGCAACAGCAGCCACAACAACAGATGCAACGGAATGGCTGGGTCAACGCG
AGTCCTTATCTCGGTAAACTCATGGTCGGCTCCCTTGCCGGCCTCATGATCCTCGAAGGCCTCGGAGAAGACGAG
AAAAGCAACGAAGAACCCCAGGGGAGGGGCCTCTTCGCTCTGCCTGTTCAATTCCTCGGCCGTCTGTCGTCGGCA
CTCGATCTTCACGTCATGGGATACCATGTCCACACCTCTCTCAGGTTATTGTTGATCATGGGTGCCTTTTTATGG
ATCTTCATCCCCATGCTCTTCTCATCGCCGGATACAAAACTCGGCAAGGGGCAGCGAGCTGCTCTCCTCAAGAGG
GCGCCGTCGCTCGCGTCTTCCATCGACGTGCGACGGCAGGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCC
AGACACAACTTCTTCCTCGAAGCCTCGGCCTTGATGCTCAAGGCACTCAAGCTCAGTCTGCGCAACGCAATCGGC
GGCCAGGCATATCAGATGTTGACGGGCCTGAGCGAGGAGGAGGAGGCGGCCCGGGTCAAGGCCTGGTCCATCGCC
CTCGACTCGCAGCTCGCGGGGGGGGACGCGGGCATCTGCAAGAGTCGCTTGATACTGACCCTGCTCGCTTCGGGC
ACCCTTCCCGACACCCCTGCTCGCCTGATGCTCAGGGCGCTCCACATCAGGGTCCTTCTGTGGGAGTTTAGCAAG
AGTAACAGGCTGCTGGGTGCCATCGACGCTGTGGCGGCGAAGCTTGCGAGGAAGCAATGGAACGAGGCGCGCCAT
CAGAATCGTCTCCTTCAGGTTCGGACGCGCCGCGGGTCTCGCACCGCTCTCGAGAACCATCTGCCGGACCACCTC
GTCGCCCTTGTCGAACAGGAGTCGGACGACGTTCTCAGCGCTTCCGTCATACAGAGGGCTCACAATCTCGCCTTT
AACGTGGACACGGCCAGCAGCATCGAGAGCCGCATCGACGGTATGGATGCCGTCGTCGACGACATCGCCGTGGGC
TCGCCTATGGACGCGGTCGCCGCCTGGTGGTCGACGCAACTCCTCCATCGCGTCCTGACGGCCACGTTGGACGAG
GACTCCCAGGCGCTGCGGAGCAAGGGCGAGGACATTACCCTGGCCATCAAAGCTGCGCCTACGGGATCCGTGGCC
CGGATCCGAGCCGTGTTGGCGCGTGCCGTCTTGGTCGAGGGATGCGGTCCCCAAGACACGGACCTGGCGCGCCGG
GCCATCGCCAAGGGGGAAGTGAACAGCTCTCTTGGCAGCCCGTCGCTGATAGGCGGGCCCGTCGCCCACGCGCCA
GATGGCGATCTGACAATCTCGCTCAAATGCGCGACGGCCATTGCTCACTTCAGACAGGCGCCGTCCGCCTCGGGC
CGGCTCGACCTCCTCCAGGGCATCGCCAAGGTGGAGCACATGCCGTCGATGACGCTGCTGGGTTTCACCGCCATG
ATGGAGTTGATGAAGCATCTTCTGGGCCAGGAGGGCCTGAGACACGAGTTTGATCTGACGCTGAGCAGGCTGTCG
AGCGGCCTCCGGCTATGGATGGGCAGACCATGGGCGTCGAGGTGCGGTGTCAGCTCTGAGCTTCGGAACAAGCTG
GTGGAGAAGTGTCTGGCGGCGACCAAGTCTCTGGCATGGCCGGACATGGACAGCGGGTGCGGCAGCCTGAGCGAC
AGCGATGACATGAACACTTGTGCGCGGACCTGA
Gene >Ophun1|1555
ATGGCCGACGACGAGTCTGCCGGCCGCTTCGGCCTCGACGAGCCCGTCTTCGGCTTCATGGGCGATGCCACTGCC
ATGCCCGCCGCCAACTCGGACCCTCCTCCCGCCTCTACCGATAATACTCAGACCTTTTACGGCCCCTCATCCTGG
GACTTCCAGGTAAACACCCCCTTCGACTCCTTCGACGTCGCCTCTTCCAGCGCGACTCCCACCGTCTCGACCGGA
GGCTCCGTCGGCCCGCCCTGGCCGCTCCCCTCCTTCGACCAGACCCAGCAGCAGCGCCAACAGCCGGTCCAGGCC
GCGTCTCCTTCCTTCGACGGCTTCTCGACGTCCCGCGTCAACCCCAAGACCGTCTTCAGCTCCAACCCATCCCTC
ACGTCCGGCTCTACCACGACGGCCAAGGCTGCTCAGGTCCGTGCGGCCTCTGGAATGTCTCACGAAGAGCTTCGA
AACATCGCCATGCCGCCTCATCTCCATTACAACTCCCCCAAGAGCGCTTCCAGCCCCGACTCGGCCAACAGCGAG
GCCAAGATTGGCGCTGCCTCCTCCCCCGAGCTCCTTGGTCTGTCCAAAAAGGACTCCCGGAAGCGAAAGGCGTCC
GACGAGCTCGAGGACGACGACGAAGTGGAAGATGGAGACAAACCTGTCAAGAAGACGGCCCACAACATGATCGAG
AAGAGGTATCGCACCAACATCAACGACAAGATTGCCGCCCTGCGCGACAGCGTTCCCAGCTTGAGGATCATGTCC
AAGAGCGCCAGGGGCGAGGACACGACCGAGGACCGCGAGGAGCTTCACGGCCTGACGCCGGCGCACAAGCTGAAC
AAGGCAACCGTAAGCCGCATTCTTGAGCCACTGGCACTCACAGTCTTGCTAACCGGCCCAACCAGGTGCTGAGCA
AGGCGACGGAATACATTCGGCATCTCGAGAAGCGAAACAGTCGTCTTACGGATGAGAACAACGCCATGAAGGAAA
GGATAGGGGCTTTCGAGAAGCTCTTCATGGCCGGAGCCATGAACGGCTCCATCAGTCCCATGCAGCACCCGCCCA
CGCCCATGTCATACCCTCAGGAGAGCCAGCAGCAGTTTACCAGTTCGCCCATGGCCACTCCGCAAGACAGCAGCT
CGAATCCTGCCGGCATGATCAATGTACCAGAGGACATGAAGCGCATCATCTCCGCCCAGATGGCTGCTGGCCAAC
CGTACCCGGTACCTTCACAGCCTTTCCGAGGAGGCAATCCAGCCGTGGTGCGCCAGCAGCAGATGCAGCAGCAGC
AGCAACAGCAACAGCAGCCACAACAACAGATGCAACGGAATGGCTGGGTCAACGCGAGTCCTTATCTCGGTAAAC
TCATGGTCGGCTCCCTTGCCGGCCTCATGATCCTCGAAGGCCTCGGAGAAGACGAGAAAAGCAACGAAGAACCCC
AGGGGAGGGGCCTCTTCGCTCTGCCTGTTCAATTCCTCGGCCGTCTGTCGTCGGCACTCGATCTTCACGTCATGG
GATACCATGTCCACACCTCTCTCAGGTTATTGTTGATCATGGGTGCCTTTTTATGGATCTTCATCCCCATGCTCT
TCTCATCGCCGGATACAAAACTCGGCAAGGGGCAGCGAGCTGCTCTCCTCAAGAGGGCGCCGTCGCTCGCGTCTT
CCATCGACGTGCGACGGCAGGCATGGCTGACGGCCATCCAGACGGTCTGGGTGCCCAGACACAACTTCTTCCTCG
AAGCCTCGGCCTTGATGCTCAAGGCACTCAAGCTCAGTCTGCGCAACGCAATCGGCGGCCAGGCATATCAGATGT
TGACGGGCCTGAGCGAGGAGGAGGAGGCGGCCCGGGTCAAGGCCTGGTCCATCGCCCTCGACTCGCAGCTCGCGG
GGGGGGACGCGGGCATCTGCAAGAGTCGCTTGATACTGACCCTGCTCGCTTCGGGCACCCTTCCCGACACCCCTG
CTCGCCTGATGCTCAGGGCGCTCCACATCAGGGTCCTTCTGTGGGAGTTTAGCAAGAGTAACAGGCTGCTGGGTG
CCATCGACGCTGTGGCGGCGAAGCTTGCGAGGAAGCAATGGAACGAGGCGCGCCATCAGAATCGTCTCCTTCAGG
TTCGGACGCGCCGCGGGTCTCGCACCGCTCTCGAGAACCATCTGCCGGACCACCTCGTCGCCCTTGTCGAACAGG
AGTCGGACGACGTTCTCAGCGCTTCCGTCATACAGAGGGCTCACAATCTCGCCTTTAACGTGGACACGGCCAGCA
GCATCGAGAGCCGCATCGACGGTATGGATGCCGTCGTCGACGACATCGCCGTGGGCTCGCCTATGGACGCGGTCG
CCGCCTGGTGGTCGACGCAACTCCTCCATCGCGTCCTGACGGCCACGTTGGACGAGGACTCCCAGGCGCTGCGGA
GCAAGGGCGAGGACATTACCCTGGCCATCAAAGCTGCGCCTACGGGATCCGTGGCCCGGATCCGAGCCGTGTTGG
CGCGTGCCGTCTTGGTCGAGGGATGCGGTCCCCAAGACACGGACCTGGCGCGCCGGGCCATCGCCAAGGGGGAAG
TGAACAGCTCTCTTGGCAGCCCGTCGCTGATAGGCGGGCCCGTCGCCCACGCGCCAGATGGCGATCTGACAATCT
CGCTCAAATGCGCGACGGCCATTGCTCACTTCAGACAGGCGCCGTCCGCCTCGGGCCGGCTCGACCTCCTCCAGG
GCATCGCCAAGGTGGAGCACATGCCGTCGATGACGCTGCTGGGTTTCACCGCCATGATGGAGTTGATGAAGCATC
TTCTGGGCCAGGAGGGCCTGAGACACGAGTTTGATCTGACGCTGAGCAGGCTGTCGAGCGGCCTCCGGCTATGGA
TGGGCAGACCATGGGCGTCGAGGTGCGGTGTCAGCTCTGAGCTTCGGAACAAGCTGGTGGAGAAGTGTCTGGCGG
CGACCAAGTCTCTGGCATGGCCGGACATGGACAGCGGGTGCGGCAGCCTGAGCGACAGCGATGACATGAACACTT
GTGCGCGGACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail