Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1531
Gene name
LocationContig_163:17963..18781
Strand+
Gene length (bp)818
Transcript length (bp)756
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Q2|STX6_PONAB Syntaxin-6 OS=Pongo abelii GN=STX6 PE=2 SV=1 91 237 5.0E-09
sp|O43752|STX6_HUMAN Syntaxin-6 OS=Homo sapiens GN=STX6 PE=1 SV=1 91 237 5.0E-09
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 91 238 2.0E-08
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 91 237 3.0E-08
sp|Q54IX6|STX8B_DICDI Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1 44 227 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5R6Q2|STX6_PONAB Syntaxin-6 OS=Pongo abelii GN=STX6 PE=2 SV=1 91 237 5.0E-09
sp|O43752|STX6_HUMAN Syntaxin-6 OS=Homo sapiens GN=STX6 PE=1 SV=1 91 237 5.0E-09
sp|Q63635|STX6_RAT Syntaxin-6 OS=Rattus norvegicus GN=Stx6 PE=1 SV=1 91 238 2.0E-08
sp|Q9JKK1|STX6_MOUSE Syntaxin-6 OS=Mus musculus GN=Stx6 PE=1 SV=1 91 237 3.0E-08
sp|Q54IX6|STX8B_DICDI Probable syntaxin-8B OS=Dictyostelium discoideum GN=syn8B PE=3 SV=1 44 227 4.0E-08
sp|Q9SA23|SYP51_ARATH Syntaxin-51 OS=Arabidopsis thaliana GN=SYP51 PE=1 SV=1 68 250 8.0E-07
sp|P83528|STX6_CAEEL Putative syntaxin 6 OS=Caenorhabditis elegans GN=syx-6 PE=3 SV=1 152 239 4.0E-06
sp|Q946Y7|SYP61_ARATH Syntaxin-61 OS=Arabidopsis thaliana GN=SYP61 PE=1 SV=1 146 250 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 233 250 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1531
MSKTNQLFLLADHIKLSLLERHRSKSLDLDCYSQDQHLTRSLDQFRDGLEILQQDKIRSEESGDFSVAESVNKDL
LVLQNRYDDLTSQFHGFSTPLSQIDSRIKDPQETTTPTATGSRKPKTVRFNDSASDQLFKPYQDDPSDDTANDDH
ISNQQLHDYQTQILDEQDEHLDQLGQSIGRQRELSMRIGDELDCHVAMLEGVEAATDRQQSRLDRASKTIGRVAK
GARENKQMTAIVVLIIILVLLIAILK*
Coding >Ophun1|1531
ATGTCGAAAACGAACCAGTTATTTCTATTGGCCGACCACATAAAACTATCACTGCTCGAGCGCCATCGCTCGAAG
AGTCTCGATCTCGACTGCTATAGCCAAGATCAGCACTTGACCAGATCTCTCGACCAATTTCGAGATGGACTTGAG
ATCCTGCAGCAAGATAAGATCCGCTCGGAAGAGTCGGGAGATTTCAGTGTCGCAGAGTCCGTCAATAAAGACCTG
CTTGTGTTGCAAAATCGTTACGACGACTTGACCAGCCAGTTCCATGGATTCTCCACACCACTCTCTCAAATAGAT
TCAAGAATTAAAGATCCGCAGGAAACCACCACTCCGACGGCCACCGGGTCCAGAAAGCCTAAGACTGTTCGTTTC
AACGACTCGGCATCCGACCAGCTATTCAAGCCCTATCAAGACGATCCATCCGACGACACAGCAAATGATGATCAC
ATCAGTAATCAACAGCTGCATGATTATCAGACGCAGATACTCGACGAGCAAGACGAACACTTGGACCAACTGGGG
CAATCTATCGGGCGCCAACGAGAACTTAGCATGCGAATTGGCGACGAGTTGGATTGTCATGTGGCTATGCTGGAA
GGTGTCGAGGCTGCCACTGATCGTCAGCAAAGTCGCCTTGACCGTGCGTCAAAGACAATCGGAAGGGTTGCCAAG
GGCGCTCGCGAAAATAAGCAGATGACTGCCATCGTTGTCTTGATAATCATCCTCGTTCTCTTGATCGCGATTTTG
AAATAG
Transcript >Ophun1|1531
ATGTCGAAAACGAACCAGTTATTTCTATTGGCCGACCACATAAAACTATCACTGCTCGAGCGCCATCGCTCGAAG
AGTCTCGATCTCGACTGCTATAGCCAAGATCAGCACTTGACCAGATCTCTCGACCAATTTCGAGATGGACTTGAG
ATCCTGCAGCAAGATAAGATCCGCTCGGAAGAGTCGGGAGATTTCAGTGTCGCAGAGTCCGTCAATAAAGACCTG
CTTGTGTTGCAAAATCGTTACGACGACTTGACCAGCCAGTTCCATGGATTCTCCACACCACTCTCTCAAATAGAT
TCAAGAATTAAAGATCCGCAGGAAACCACCACTCCGACGGCCACCGGGTCCAGAAAGCCTAAGACTGTTCGTTTC
AACGACTCGGCATCCGACCAGCTATTCAAGCCCTATCAAGACGATCCATCCGACGACACAGCAAATGATGATCAC
ATCAGTAATCAACAGCTGCATGATTATCAGACGCAGATACTCGACGAGCAAGACGAACACTTGGACCAACTGGGG
CAATCTATCGGGCGCCAACGAGAACTTAGCATGCGAATTGGCGACGAGTTGGATTGTCATGTGGCTATGCTGGAA
GGTGTCGAGGCTGCCACTGATCGTCAGCAAAGTCGCCTTGACCGTGCGTCAAAGACAATCGGAAGGGTTGCCAAG
GGCGCTCGCGAAAATAAGCAGATGACTGCCATCGTTGTCTTGATAATCATCCTCGTTCTCTTGATCGCGATTTTG
AAATAG
Gene >Ophun1|1531
ATGTCGAAAACGAACCAGTTATTTCTATTGGCCGACCACATAAAACTATCACTGCTCGAGCGCCATCGCTCGAAG
AGTCTCGATCTCGACTGCTATAGCCAAGATCAGCACTTGACCAGATCTCTCGACCAATTTCGAGATGGACTTGAG
ATCCTGCAGCAAGATAAGATCCGCTCGGAAGAGTCGGGAGATTTCAGGTGTGGCACTCCCTTACGATCAACACGG
GTCGGTTGAGCGCACGTGTACTCATTCCTTCCAGTGTCGCAGAGTCCGTCAATAAAGACCTGCTTGTGTTGCAAA
ATCGTTACGACGACTTGACCAGCCAGTTCCATGGATTCTCCACACCACTCTCTCAAATAGATTCAAGAATTAAAG
ATCCGCAGGAAACCACCACTCCGACGGCCACCGGGTCCAGAAAGCCTAAGACTGTTCGTTTCAACGACTCGGCAT
CCGACCAGCTATTCAAGCCCTATCAAGACGATCCATCCGACGACACAGCAAATGATGATCACATCAGTAATCAAC
AGCTGCATGATTATCAGACGCAGATACTCGACGAGCAAGACGAACACTTGGACCAACTGGGGCAATCTATCGGGC
GCCAACGAGAACTTAGCATGCGAATTGGCGACGAGTTGGATTGTCATGTGGCTATGCTGGAAGGTGTCGAGGCTG
CCACTGATCGTCAGCAAAGTCGCCTTGACCGTGCGTCAAAGACAATCGGAAGGGTTGCCAAGGGCGCTCGCGAAA
ATAAGCAGATGACTGCCATCGTTGTCTTGATAATCATCCTCGTTCTCTTGATCGCGATTTTGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail