Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1530
Gene name
LocationContig_163:14479..16827
Strand-
Gene length (bp)2348
Transcript length (bp)2142
Coding sequence length (bp)2142
Protein length (aa) 714

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02383 Syja_N SacI homology domain 7.8E-78 78 408

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 1 693 0.0E+00
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 1 681 3.0E-173
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 1 681 7.0E-172
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 3 665 8.0E-168
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 1 585 4.0E-129
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P42837|FIG4_YEAST Polyphosphoinositide phosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FIG4 PE=1 SV=1 1 693 0.0E+00
sp|Q92562|FIG4_HUMAN Polyphosphoinositide phosphatase OS=Homo sapiens GN=FIG4 PE=1 SV=1 1 681 3.0E-173
sp|Q91WF7|FIG4_MOUSE Polyphosphoinositide phosphatase OS=Mus musculus GN=Fig4 PE=1 SV=1 1 681 7.0E-172
sp|Q7Z9H9|FIG4_SCHPO Polyphosphoinositide phosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1093.03 PE=3 SV=3 3 665 8.0E-168
sp|Q7XZU3|SAC1_ARATH Phosphoinositide phosphatase SAC1 OS=Arabidopsis thaliana GN=SAC1 PE=1 SV=1 1 585 4.0E-129
sp|Q7XZU1|SAC4_ARATH Phosphoinositide phosphatase SAC4 OS=Arabidopsis thaliana GN=SAC4 PE=2 SV=1 1 583 1.0E-128
sp|Q7XZU2|SAC3_ARATH Phosphoinositide phosphatase SAC3 OS=Arabidopsis thaliana GN=SAC3 PE=2 SV=1 1 578 1.0E-124
sp|Q94A27|SAC2_ARATH Phosphoinositide phosphatase SAC2 OS=Arabidopsis thaliana GN=SAC2 PE=2 SV=1 1 587 7.0E-121
sp|Q8RW97|SAC5_ARATH Phosphoinositide phosphatase SAC5 OS=Arabidopsis thaliana GN=SAC5 PE=2 SV=1 1 583 3.0E-105
sp|Q6GM29|SAC1_XENLA Phosphatidylinositide phosphatase SAC1 OS=Xenopus laevis GN=sacm1l PE=2 SV=1 4 566 9.0E-51
sp|Q9W0I6|SAC1_DROME Phosphatidylinositide phosphatase SAC1 OS=Drosophila melanogaster GN=Sac1 PE=2 SV=1 78 567 3.0E-50
sp|Q55AW9|SAC1_DICDI Phosphatidylinositide phosphatase SAC1 OS=Dictyostelium discoideum GN=sac1 PE=3 SV=1 78 562 3.0E-49
sp|A1L244|SAC1A_DANRE Phosphatidylinositide phosphatase SAC1-A OS=Danio rerio GN=sacm1la PE=2 SV=1 2 592 2.0E-48
sp|A6QL88|SAC1_BOVIN Phosphatidylinositide phosphatase SAC1 OS=Bos taurus GN=SACM1L PE=2 SV=1 77 566 5.0E-48
sp|Q9ES21|SAC1_RAT Phosphatidylinositide phosphatase SAC1 OS=Rattus norvegicus GN=Sacm1l PE=1 SV=1 77 566 5.0E-48
sp|A4VCH0|SAC1B_DANRE Phosphatidylinositide phosphatase SAC1-B OS=Danio rerio GN=sacm1lb PE=2 SV=2 2 566 7.0E-47
sp|Q9C5G5|SAC7_ARATH Phosphoinositide phosphatase SAC7 OS=Arabidopsis thaliana GN=SAC7 PE=2 SV=1 55 574 9.0E-47
sp|Q9EP69|SAC1_MOUSE Phosphatidylinositide phosphatase SAC1 OS=Mus musculus GN=Sacm1l PE=1 SV=1 77 566 2.0E-46
sp|O60162|YG23_SCHPO Uncharacterized protein C19F5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC19F5.03 PE=1 SV=1 79 566 2.0E-46
sp|Q5R921|SAC1_PONAB Phosphatidylinositide phosphatase SAC1 OS=Pongo abelii GN=SACM1L PE=2 SV=1 77 566 4.0E-45
sp|Q9NTJ5|SAC1_HUMAN Phosphatidylinositide phosphatase SAC1 OS=Homo sapiens GN=SACM1L PE=1 SV=2 77 566 6.0E-45
sp|Q96328|SAC8_ARATH Phosphoinositide phosphatase SAC8 OS=Arabidopsis thaliana GN=SAC8 PE=2 SV=1 62 573 2.0E-44
sp|Q7X911|SAC6_ARATH Phosphoinositide phosphatase SAC6 OS=Arabidopsis thaliana GN=SAC6 PE=2 SV=1 34 574 1.0E-43
sp|P32368|SAC1_YEAST Phosphoinositide phosphatase SAC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAC1 PE=1 SV=1 79 566 1.0E-37
sp|Q12271|INP53_YEAST Polyphosphatidylinositol phosphatase INP53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP53 PE=1 SV=1 77 582 6.0E-37
sp|P50942|INP52_YEAST Polyphosphatidylinositol phosphatase INP52 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP52 PE=1 SV=1 148 564 4.0E-34
sp|A8E7C5|SAC2_DANRE Phosphatidylinositide phosphatase SAC2 OS=Danio rerio GN=inpp5f PE=3 SV=1 133 567 2.0E-33
sp|Q8CDA1|SAC2_MOUSE Phosphatidylinositide phosphatase SAC2 OS=Mus musculus GN=Inpp5f PE=1 SV=1 146 564 2.0E-32
sp|O43001|SYJ1_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj1 PE=1 SV=1 77 591 8.0E-32
sp|Q9Y2H2|SAC2_HUMAN Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens GN=INPP5F PE=1 SV=3 146 564 9.0E-32
sp|O14127|YF51_SCHPO Uncharacterized protein C3C7.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3C7.01c PE=3 SV=2 81 566 2.0E-31
sp|O43426|SYNJ1_HUMAN Synaptojanin-1 OS=Homo sapiens GN=SYNJ1 PE=1 SV=2 77 567 6.0E-30
sp|Q62910|SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus GN=Synj1 PE=1 SV=3 77 567 3.0E-29
sp|Q8CHC4|SYNJ1_MOUSE Synaptojanin-1 OS=Mus musculus GN=Synj1 PE=1 SV=3 77 567 3.0E-29
sp|O18964|SYNJ1_BOVIN Synaptojanin-1 (Fragment) OS=Bos taurus GN=SYNJ1 PE=1 SV=2 77 567 6.0E-29
sp|Q9D2G5|SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus GN=Synj2 PE=1 SV=2 77 570 9.0E-27
sp|O55207|SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus GN=Synj2 PE=1 SV=2 90 570 1.0E-26
sp|O15056|SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens GN=SYNJ2 PE=1 SV=3 77 575 6.0E-25
sp|Q7XZU0|SAC9_ARATH Probable phosphoinositide phosphatase SAC9 OS=Arabidopsis thaliana GN=SAC9 PE=1 SV=1 14 496 1.0E-21
sp|Q9USQ6|SYJ2_SCHPO Inositol-1,4,5-trisphosphate 5-phosphatase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syj2 PE=2 SV=1 244 585 2.0E-14
sp|P40559|INP51_YEAST Phosphatidylinositol 4,5-bisphosphate 5-phosphatase INP51 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INP51 PE=1 SV=1 74 473 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016791 phosphatase activity Yes
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No
GO:0016788 hydrolase activity, acting on ester bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5214
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5665
Ophiocordyceps australis map64 (Brazil) OphauB2|4073
Ophiocordyceps camponoti-floridani Ophcf2|05621
Ophiocordyceps camponoti-rufipedis Ophun1|1530 (this protein)
Ophiocordyceps kimflemingae Ophio5|8622
Ophiocordyceps subramaniannii Hirsu2|4155

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1530
MHKFSLYETASRYYVVGVDVGETRYRILKIDRTTDGTELNLTDDKIVYTLKEMNQLLDTIDDGNRGTGGIKLRCS
TWGILGFIKFTGPYYMLLITKKSTVAMVGGHYIYQVEGTDLIPLTPGRFKSDVRNTQEQRFLGILNNLDLTRSFY
YSYSYDVTRTLQHNIARAKTAAASGALPPDDDFNAMFVWNHYLLEPVVVALADTYDWCRPIIHGYIDQAGKDLRI
SSIYESSFCKQALSIYGRTAHITVIARRSRLFAGARFLKRGANDLGYVANDVETEQIVAESLTTSFHAPGGRFYC
NPQYTSYVQHRGSIPLYWTQDNTGVTPKPPIELNLVDPFYGAAALHFNDLFRRYGAPVYVLNLVKAKERQPRESK
LLEEYTHAIDYLNQFLPPSKKIIHKAWDMSRASKARGGDVIGNLEIIAESVLATTGFFHNGDGLTSPLSTQTGVA
RTNCIDCLDRTNAAQFVIGKRALGHQLHALGILADTFVPYDTDAVNLFTHMWHDHGDTIAVQYGGSQLVNTMETY
RKINQWTSHSRDMIESFKRYYNNSFLDNQRQEAYNLFLGNYIFTKGQPMLWDLANDYYLHHADPRDWSAANQADY
INWYDGSHLEAKPAAPYPRLRASAATLSVEFFDDFWLEYYRPSTLSSFPKMFAYKMNSTIKYIPLRSAQDGKYDL
SPFRVRTDGDMEDERKKVKKQLNSTGAWQAIRGLVANR*
Coding >Ophun1|1530
ATGCACAAGTTCAGTTTGTACGAAACGGCTAGTCGTTACTATGTCGTTGGTGTGGATGTCGGCGAGACGCGGTAT
AGAATCCTCAAGATCGACAGGACTACGGATGGTACGGAGCTGAACCTGACCGACGATAAAATTGTGTACACTTTG
AAGGAAATGAACCAGCTCTTGGACACAATTGATGATGGAAATCGTGGAACTGGAGGTATCAAACTGCGCTGCAGC
ACTTGGGGCATATTGGGTTTCATCAAATTCACTGGACCGTACTACATGCTTCTTATCACGAAGAAGAGTACCGTC
GCCATGGTCGGTGGCCACTACATCTATCAGGTGGAAGGCACTGATTTGATCCCTCTCACCCCTGGGCGGTTCAAA
TCGGACGTTAGAAACACGCAGGAGCAAAGGTTCCTCGGGATTCTCAACAACTTAGATCTCACCAGATCTTTCTAC
TATAGTTATTCGTACGACGTGACTCGCACACTTCAACACAACATCGCCAGGGCCAAAACAGCGGCTGCGTCTGGC
GCATTGCCACCTGATGATGACTTCAATGCCATGTTCGTTTGGAACCACTACCTGCTTGAGCCGGTTGTCGTTGCC
CTTGCCGATACCTATGATTGGTGTCGACCCATCATCCATGGCTACATTGACCAAGCAGGTAAGGACCTCCGTATC
TCCTCCATTTACGAAAGCTCATTTTGCAAGCAAGCTCTTTCGATATACGGCCGAACTGCGCATATAACTGTCATT
GCACGTCGATCTCGGCTGTTTGCTGGAGCCAGATTCTTGAAACGTGGTGCGAACGATCTGGGCTATGTTGCCAAT
GATGTAGAGACGGAGCAGATCGTCGCCGAATCTCTCACGACATCATTTCACGCACCCGGAGGAAGATTTTACTGC
AATCCCCAATACACGTCTTATGTGCAACATCGCGGGAGCATCCCTCTATACTGGACCCAGGACAACACAGGAGTG
ACGCCGAAGCCCCCAATCGAACTGAACCTTGTCGATCCGTTCTATGGCGCCGCTGCTCTGCACTTTAATGACCTG
TTCAGGCGTTACGGAGCGCCCGTTTACGTGCTGAACCTAGTCAAGGCAAAGGAGAGGCAGCCGCGAGAGTCCAAA
CTACTAGAAGAATATACACACGCCATCGACTATCTCAACCAATTCTTGCCGCCAAGCAAGAAAATCATACACAAA
GCCTGGGACATGAGCCGGGCTTCCAAAGCCCGAGGCGGGGATGTGATCGGCAATCTGGAAATCATCGCTGAATCT
GTTTTGGCTACCACTGGCTTCTTTCACAACGGCGACGGCCTCACAAGTCCCTTGTCGACTCAAACTGGTGTAGCT
CGGACAAATTGCATCGACTGCTTGGACCGGACAAATGCCGCCCAGTTTGTCATTGGCAAACGAGCGCTGGGTCAC
CAGCTGCATGCCTTGGGCATTCTGGCTGACACATTCGTGCCTTACGACACGGATGCAGTGAACCTCTTTACCCAC
ATGTGGCATGATCACGGGGATACTATCGCAGTACAATACGGGGGCTCGCAGCTCGTCAACACCATGGAAACGTAT
CGGAAAATAAACCAGTGGACTAGTCACTCCCGTGACATGATTGAGAGCTTTAAGCGATATTATAATAATTCCTTC
CTCGATAACCAACGTCAAGAGGCGTACAATCTCTTTCTGGGCAATTACATCTTCACAAAGGGACAGCCAATGCTA
TGGGACCTTGCCAATGACTACTATCTTCATCACGCGGACCCGAGAGACTGGTCTGCCGCGAATCAAGCGGACTAC
ATTAATTGGTACGACGGAAGTCATCTGGAAGCCAAACCAGCCGCTCCTTATCCTCGCTTGCGGGCTTCGGCCGCC
ACACTTTCTGTTGAATTCTTCGACGACTTCTGGCTCGAGTACTATCGGCCGTCTACGCTGTCGTCTTTTCCCAAG
ATGTTTGCTTACAAGATGAACTCCACTATCAAATATATTCCTTTGCGATCGGCTCAAGACGGTAAGTATGATCTA
AGTCCCTTTCGGGTCCGTACGGATGGCGACATGGAGGACGAGAGAAAGAAGGTGAAGAAGCAGTTGAACTCCACC
GGTGCCTGGCAGGCTATCAGGGGACTCGTCGCAAACCGCTGA
Transcript >Ophun1|1530
ATGCACAAGTTCAGTTTGTACGAAACGGCTAGTCGTTACTATGTCGTTGGTGTGGATGTCGGCGAGACGCGGTAT
AGAATCCTCAAGATCGACAGGACTACGGATGGTACGGAGCTGAACCTGACCGACGATAAAATTGTGTACACTTTG
AAGGAAATGAACCAGCTCTTGGACACAATTGATGATGGAAATCGTGGAACTGGAGGTATCAAACTGCGCTGCAGC
ACTTGGGGCATATTGGGTTTCATCAAATTCACTGGACCGTACTACATGCTTCTTATCACGAAGAAGAGTACCGTC
GCCATGGTCGGTGGCCACTACATCTATCAGGTGGAAGGCACTGATTTGATCCCTCTCACCCCTGGGCGGTTCAAA
TCGGACGTTAGAAACACGCAGGAGCAAAGGTTCCTCGGGATTCTCAACAACTTAGATCTCACCAGATCTTTCTAC
TATAGTTATTCGTACGACGTGACTCGCACACTTCAACACAACATCGCCAGGGCCAAAACAGCGGCTGCGTCTGGC
GCATTGCCACCTGATGATGACTTCAATGCCATGTTCGTTTGGAACCACTACCTGCTTGAGCCGGTTGTCGTTGCC
CTTGCCGATACCTATGATTGGTGTCGACCCATCATCCATGGCTACATTGACCAAGCAGGTAAGGACCTCCGTATC
TCCTCCATTTACGAAAGCTCATTTTGCAAGCAAGCTCTTTCGATATACGGCCGAACTGCGCATATAACTGTCATT
GCACGTCGATCTCGGCTGTTTGCTGGAGCCAGATTCTTGAAACGTGGTGCGAACGATCTGGGCTATGTTGCCAAT
GATGTAGAGACGGAGCAGATCGTCGCCGAATCTCTCACGACATCATTTCACGCACCCGGAGGAAGATTTTACTGC
AATCCCCAATACACGTCTTATGTGCAACATCGCGGGAGCATCCCTCTATACTGGACCCAGGACAACACAGGAGTG
ACGCCGAAGCCCCCAATCGAACTGAACCTTGTCGATCCGTTCTATGGCGCCGCTGCTCTGCACTTTAATGACCTG
TTCAGGCGTTACGGAGCGCCCGTTTACGTGCTGAACCTAGTCAAGGCAAAGGAGAGGCAGCCGCGAGAGTCCAAA
CTACTAGAAGAATATACACACGCCATCGACTATCTCAACCAATTCTTGCCGCCAAGCAAGAAAATCATACACAAA
GCCTGGGACATGAGCCGGGCTTCCAAAGCCCGAGGCGGGGATGTGATCGGCAATCTGGAAATCATCGCTGAATCT
GTTTTGGCTACCACTGGCTTCTTTCACAACGGCGACGGCCTCACAAGTCCCTTGTCGACTCAAACTGGTGTAGCT
CGGACAAATTGCATCGACTGCTTGGACCGGACAAATGCCGCCCAGTTTGTCATTGGCAAACGAGCGCTGGGTCAC
CAGCTGCATGCCTTGGGCATTCTGGCTGACACATTCGTGCCTTACGACACGGATGCAGTGAACCTCTTTACCCAC
ATGTGGCATGATCACGGGGATACTATCGCAGTACAATACGGGGGCTCGCAGCTCGTCAACACCATGGAAACGTAT
CGGAAAATAAACCAGTGGACTAGTCACTCCCGTGACATGATTGAGAGCTTTAAGCGATATTATAATAATTCCTTC
CTCGATAACCAACGTCAAGAGGCGTACAATCTCTTTCTGGGCAATTACATCTTCACAAAGGGACAGCCAATGCTA
TGGGACCTTGCCAATGACTACTATCTTCATCACGCGGACCCGAGAGACTGGTCTGCCGCGAATCAAGCGGACTAC
ATTAATTGGTACGACGGAAGTCATCTGGAAGCCAAACCAGCCGCTCCTTATCCTCGCTTGCGGGCTTCGGCCGCC
ACACTTTCTGTTGAATTCTTCGACGACTTCTGGCTCGAGTACTATCGGCCGTCTACGCTGTCGTCTTTTCCCAAG
ATGTTTGCTTACAAGATGAACTCCACTATCAAATATATTCCTTTGCGATCGGCTCAAGACGGTAAGTATGATCTA
AGTCCCTTTCGGGTCCGTACGGATGGCGACATGGAGGACGAGAGAAAGAAGGTGAAGAAGCAGTTGAACTCCACC
GGTGCCTGGCAGGCTATCAGGGGACTCGTCGCAAACCGCTGA
Gene >Ophun1|1530
ATGCACAAGTTCAGTTTGTACGAAACGGCTAGTCGTTACTATGTCGTTGGTGTGGATGTCGGCGAGACGCGGTAT
AGAATCCTCAAGATCGACAGGACTACGGATGGTACGGAGCTGAACCTGACCGACGATAAAATTGTGTACACTTTG
AAGGAAATGAACCAGCTCTTGGACACAATTGATGATGGAAATCGTGGAACTGGAGGTATCAAACTGCGCTGCAGC
ACTTGGGGCATATTGGGTTTCATCAAATTCACTGGACCGTACTACATGCTTCTTATCACGAAGAAGAGTACCGTC
GCCATGGTCGGTGGCCACTACATCTATCAGGTGGAAGGCACTGATTTGATCCCTCTCACCCCTGGGCGGTTCAAA
TCGGACGTTAGAAACACGCAGGAGCAAAGGTTCCTCGGGATTCTCAACAACTTAGATCTCACCAGATCTTTCTAC
TATAGTTATTCGTACGACGTGACTCGCACACTTCAACACAACATCGCCAGGGCCAAAACAGCGGCTGCGTCTGGC
GCATTGCCACCTGATGATGACTTCAATGCCATGTTCGTTTGGAACCACTACCTGCTTGAGCCGGTTGTCGTTGCC
CTTGCCGATACCTATGATTGGTGTCGACCCATCATCCATGGCTACATTGACCAAGCAGGTAAGGACCTCCGTATC
TCCTCCATTTACGAAAGCTCATTTTGCAAGCAAGCTCTTTCGATATACGGCCGAACTGCGCATATAACTGTCATT
GCACGTCGATCTCGGCTGTTTGCTGGAGCCAGATTCTTGAAACGTGGTGCGAACGATCTGGTAAGTGTTGAACCT
AATAGTCTCCTATCATTATCATAATCCCGAATGGGAAGAGATGGCATACAGTTTGCCAACTCATCCTAGCTAACG
ATTGTGTTCAAGGGCTATGTTGCCAATGATGTAGAGACGGAGCAGATCGTCGCCGAATCTCTCACGACATCATTT
CACGCACCCGGAGGAAGATTTTACTGCAATCCCCAATACACGTCTTATGTGCAACATCGCGGGAGCATCCCTCTA
TACTGGACCCAGGACAACACAGGAGTGACGCCGAAGCCCCCAATCGAACTGAACCTTGTCGATCCGTTCTATGGC
GCCGCTGCTCTGCACTTTAATGACCTGTTCAGGCGTTACGGAGCGCCCGTTTACGTGCTGAACCTAGTCAAGGCA
AAGGAGAGGCAGCCGCGAGAGTCCAAACTACTAGAAGAATATACACACGCCATCGACTATCTCAACCAATTCTTG
CCGCCAAGCAAGAAAATCATACACAAAGCCTGGGACATGAGCCGGGCTTCCAAAGCCCGAGGCGGGGATGTGATC
GGCAATCTGGAAATCATCGCTGAATCTGTTTTGGCTACCACTGGCTTCTTTCACAACGGCGACGGCCTCACAAGT
CCCTTGTCGACTCAAACTGGTGTAGCTCGGACAAATTGCATCGACTGCTTGGACCGGACAAATGCCGCCCAGTTT
GTCATTGGCAAACGAGCGCTGGGTCACCAGCTGCATGCCTTGGGCATTCTGGCTGACACATTCGTGCCTTACGAC
ACGGATGCAGTGAACCTCTTTACCCACATGTGGCATGATCACGGGGATACTATCGCAGTACAATACGGGGGCTCG
CAGCTCGTCAACACCATGGAAACGTATCGGAAAATAAACCAGTGGACTAGTCACTCCCGTGACATGATTGAGAGC
TTTAAGCGATATTATAATAATTCCTTCCTCGATAACCAACGTCAAGAGGCGTACAATCTCTTTCTGGGCAATTAC
ATCTTCACAAAGGGACAGCCAATGCTATGGGACCTTGCCAATGACTACTATCTTCATCACGCGGACCCGAGAGAC
TGGTCTGCCGCGAATCAAGCGGACTACATTAATTGGTACGACGGAAGTCATCTGGAAGCCAAACCAGCCGCTCCT
TATCCTCGCTTGCGGGCTTCGGCCGCCACACTTTCTGTTGAATTCTTCGACGACTTCTGGCTCGAGTACTATCGG
CCGTCTACGCTGTCGTCTTTTCCCAAGATGTTTGCTTACAAGATGAACTCCACTATCAAATATATTCCTTTGCGA
TCGGCTCAAGACGGTAAGTATGATCTAAGTCCCTTTCGGGTCCGTACGGATGGCGACATGGAGGACGAGAGAAAG
AAGGTGAAGAAGCAGTTGAACTCCAGTCCGTATCAATCGCCGCATATTGCTGTCAGGGACAACGATAGCATTTCA
ACAACTTCGGGCCGCACAGCCACCAGAGGAGTTCCCATTCAACGCTGGCTGCAGCCGGTGCCTGGCAGGCTATCA
GGGGACTCGTCGCAAACCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail