Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1525
Gene name
LocationContig_1623:575..1091
Strand+
Gene length (bp)516
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00125 Histone Core histone H2A/H2B/H3/H4 7.9E-49 1 132
PF15715 PAF PCNA-associated factor histone like domain 7.6E-05 1 58

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P07041|H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh3 PE=1 SV=3 1 136 5.0E-94
sp|Q5DWI3|H3_MARPO Histone H3 OS=Marchantia polymorpha PE=3 SV=3 1 136 5.0E-94
sp|A4RCX7|H3_MAGO7 Histone H3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HHT1 PE=3 SV=1 1 136 5.0E-94
sp|P61835|H3_HYPJE Histone H3 OS=Hypocrea jecorina GN=HHT1 PE=3 SV=2 1 136 5.0E-94
sp|Q4IER8|H3_GIBZE Histone H3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HHT1 PE=3 SV=3 1 136 5.0E-94
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P07041|H3_NEUCR Histone H3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hh3 PE=1 SV=3 1 136 5.0E-94
sp|Q5DWI3|H3_MARPO Histone H3 OS=Marchantia polymorpha PE=3 SV=3 1 136 5.0E-94
sp|A4RCX7|H3_MAGO7 Histone H3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HHT1 PE=3 SV=1 1 136 5.0E-94
sp|P61835|H3_HYPJE Histone H3 OS=Hypocrea jecorina GN=HHT1 PE=3 SV=2 1 136 5.0E-94
sp|Q4IER8|H3_GIBZE Histone H3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HHT1 PE=3 SV=3 1 136 5.0E-94
sp|Q6DL03|H3_CHAGB Histone H3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HHT1 PE=2 SV=3 1 136 5.0E-94
sp|Q0UY45|H3_PHANO Histone H3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HHT1 PE=3 SV=1 1 136 2.0E-92
sp|P61834|H3_TALFU Histone H3 OS=Talaromyces funiculosus GN=HHT1 PE=3 SV=2 1 136 3.0E-92
sp|A1D240|H3_NEOFI Histone H3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=hht1 PE=3 SV=1 1 136 3.0E-92
sp|P23753|H3_EMENI Histone H3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hhtA PE=3 SV=2 1 136 3.0E-92
sp|Q0D0E8|H3_ASPTN Histone H3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hht1 PE=3 SV=1 1 136 3.0E-92
sp|Q2UCQ0|H3_ASPOR Histone H3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hhtA PE=3 SV=3 1 136 3.0E-92
sp|A2QRR5|H3_ASPNC Histone H3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=hht1 PE=3 SV=1 1 136 3.0E-92
sp|P61832|H3_ASPFU Histone H3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hhtA PE=3 SV=2 1 136 3.0E-92
sp|A1CP80|H3_ASPCL Histone H3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=hht1 PE=3 SV=1 1 136 3.0E-92
sp|Q9P427|H3_AJECA Histone H3 OS=Ajellomyces capsulatus GN=HHT1 PE=3 SV=3 1 136 2.0E-91
sp|A3LXD5|H31_PICST Histone H3.1/H3.2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HHT1 PE=3 SV=1 1 136 8.0E-91
sp|A5DFC5|H31_PICGU Histone H3.1/H3.2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HHT1 PE=3 SV=1 1 136 8.0E-91
sp|Q6BRZ5|H31_DEBHA Histone H3.1/H3.2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HHT1 PE=3 SV=3 1 136 8.0E-91
sp|A5DG57|H33_PICGU Histone H3.3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HHT3 PE=3 SV=1 1 136 6.0E-90
sp|A5DWE2|H31_LODEL Histone H3.1/H3.2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HHT1 PE=3 SV=1 1 136 1.0E-89
sp|A3GHN6|H33_PICST Histone H3.3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HHT3 PE=3 SV=1 1 136 2.0E-89
sp|Q6BMU4|H33_DEBHA Histone H3.3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HHT3 PE=3 SV=3 1 136 2.0E-89
sp|Q59VN2|H31_CANAL Histone H3.1/H3.2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HHT1 PE=3 SV=3 1 136 2.0E-89
sp|P61836|H3_ZYGBA Histone H3 OS=Zygosaccharomyces bailii GN=HHT1 PE=3 SV=2 1 136 6.0E-89
sp|P61830|H3_YEAST Histone H3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HHT1 PE=1 SV=2 1 136 6.0E-89
sp|P61831|H3_KLULA Histone H3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HHT1 PE=1 SV=2 1 136 6.0E-89
sp|P61833|H3_CANGA Histone H3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HHT1 PE=3 SV=2 1 136 6.0E-89
sp|Q757N1|H3_ASHGO Histone H3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HHT1 PE=3 SV=3 1 136 6.0E-89
sp|A5E094|H33_LODEL Histone H3.3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HHT3 PE=3 SV=1 1 136 1.0E-88
sp|P09988|H31_SCHPO Histone H3.1/H3.2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hht1 PE=1 SV=2 1 136 2.0E-88
sp|Q5ADQ0|H33_CANAL Histone H3.3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HHT3 PE=3 SV=3 1 136 2.0E-88
sp|P10651|H33_SCHPO Histone H3.3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hht3 PE=1 SV=2 1 136 4.0E-87
sp|Q8WSF1|H33_TRIPS Histone H3.3 OS=Trichinella pseudospiralis GN=HHT3 PE=2 SV=3 1 135 1.0E-86
sp|Q6P823|H33_XENTR Histone H3.3 OS=Xenopus tropicalis GN=TGas113e22.1 PE=1 SV=3 1 135 2.0E-86
sp|Q6PI79|H33_XENLA Histone H3.3 OS=Xenopus laevis PE=1 SV=3 1 135 2.0E-86
sp|P84248|H33_SPISO Histone H3.3 OS=Spisula solidissima PE=2 SV=2 1 135 2.0E-86
sp|P84245|H33_RAT Histone H3.3 OS=Rattus norvegicus GN=H3f3b PE=1 SV=2 1 135 2.0E-86
sp|P84246|H33_RABIT Histone H3.3 OS=Oryctolagus cuniculus GN=H3F3A PE=2 SV=2 1 135 2.0E-86
sp|Q71LE2|H33_PIG Histone H3.3 OS=Sus scrofa GN=H3F3A PE=2 SV=3 1 135 2.0E-86
sp|P84244|H33_MOUSE Histone H3.3 OS=Mus musculus GN=H3f3a PE=1 SV=2 1 135 2.0E-86
sp|P84243|H33_HUMAN Histone H3.3 OS=Homo sapiens GN=H3F3A PE=1 SV=2 1 135 2.0E-86
sp|P84249|H33_DROME Histone H3.3 OS=Drosophila melanogaster GN=His3.3A PE=1 SV=2 1 135 2.0E-86
sp|P84250|H33_DROHY Histone H3.3 OS=Drosophila hydei GN=His3.3A PE=3 SV=2 1 135 2.0E-86
sp|Q6PI20|H33_DANRE Histone H3.3 OS=Danio rerio GN=h3f3a PE=2 SV=3 1 135 2.0E-86
sp|P84247|H33_CHICK Histone H3.3 OS=Gallus gallus GN=H3-IX PE=1 SV=2 1 135 2.0E-86
sp|Q5E9F8|H33_BOVIN Histone H3.3 OS=Bos taurus GN=H3F3A PE=1 SV=3 1 135 2.0E-86
sp|Q9HDN1|H3_MORAP Histone H3 OS=Mortierella alpina GN=H3.1 PE=3 SV=3 1 136 2.0E-86
sp|Q4P7J7|H31_USTMA Histone H3.1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HHT1 PE=3 SV=3 1 136 3.0E-86
sp|Q10453|H331_CAEEL Histone H3.3 type 1 OS=Caenorhabditis elegans GN=his-71 PE=1 SV=2 1 135 4.0E-86
sp|Q5RCC9|H33_PONAB Histone H3.3 OS=Pongo abelii PE=2 SV=3 1 135 8.0E-86
sp|Q9U281|H332_CAEEL Histone H3.3 type 2 OS=Caenorhabditis elegans GN=his-72 PE=1 SV=3 1 135 9.0E-86
sp|Q1E225|H3_COCIM Histone H3 OS=Coccidioides immitis (strain RS) GN=HHT1 PE=3 SV=1 1 136 2.0E-85
sp|Q6LED0|H31_RAT Histone H3.1 OS=Rattus norvegicus PE=1 SV=3 1 135 2.0E-85
sp|Q6LBF0|H31_MUSPA Histone H3.1 OS=Mus pahari GN=H3110 PE=2 SV=3 1 135 2.0E-85
sp|P68433|H31_MOUSE Histone H3.1 OS=Mus musculus GN=Hist1h3a PE=1 SV=2 1 135 2.0E-85
sp|P68431|H31_HUMAN Histone H3.1 OS=Homo sapiens GN=HIST1H3A PE=1 SV=2 1 135 2.0E-85
sp|P68432|H31_BOVIN Histone H3.1 OS=Bos taurus PE=1 SV=2 1 135 2.0E-85
sp|Q4PB04|H32_USTMA Histone H3.2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HHT2 PE=3 SV=3 1 136 3.0E-85
sp|P84239|H3_URECA Histone H3 OS=Urechis caupo PE=1 SV=2 1 135 4.0E-85
sp|P84237|H3_TIGCA Histone H3 OS=Tigriopus californicus PE=3 SV=2 1 135 4.0E-85
sp|P84235|H3_PLADU Histone H3 OS=Platynereis dumerilii PE=3 SV=2 1 135 4.0E-85
sp|P02299|H3_DROME Histone H3 OS=Drosophila melanogaster GN=His3 PE=1 SV=4 1 135 4.0E-85
sp|P84236|H3_DROHY Histone H3 OS=Drosophila hydei GN=His3 PE=3 SV=2 1 135 4.0E-85
sp|P84238|H3_CHITH Histone H3 OS=Chironomus thummi thummi PE=3 SV=2 1 135 4.0E-85
sp|Q28D37|H32_XENTR Histone H3.2 OS=Xenopus tropicalis GN=TGas081o10.1 PE=2 SV=3 1 135 4.0E-85
sp|P84233|H32_XENLA Histone H3.2 OS=Xenopus laevis PE=1 SV=2 1 135 4.0E-85
sp|P84232|H32_PORAF Histone H3.2 OS=Poroderma africanum PE=1 SV=2 1 135 4.0E-85
sp|P84234|H32_ONCMY Histone H3.2 OS=Oncorhynchus mykiss PE=1 SV=2 1 135 4.0E-85
sp|Q6LBE8|H32_MUSPA Histone H3.2 OS=Mus pahari GN=H312 PE=2 SV=3 1 135 4.0E-85
sp|P84228|H32_MOUSE Histone H3.2 OS=Mus musculus GN=Hist1h3b PE=1 SV=2 1 135 4.0E-85
sp|P84231|H32_ICTBU Histone H3.2 OS=Ictiobus bubalus PE=1 SV=2 1 135 4.0E-85
sp|Q71DI3|H32_HUMAN Histone H3.2 OS=Homo sapiens GN=HIST2H3A PE=1 SV=3 1 135 4.0E-85
sp|Q4QRF4|H32_DANRE Histone H3.2 OS=Danio rerio GN=zgc:113984 PE=2 SV=3 1 135 4.0E-85
sp|P84229|H32_CHICK Histone H3.2 OS=Gallus gallus GN=H3-I PE=1 SV=2 1 135 4.0E-85
sp|P84230|H32_CAIMO Histone H3.2 OS=Cairina moschata PE=2 SV=2 1 135 4.0E-85
sp|P84227|H32_BOVIN Histone H3.2 OS=Bos taurus PE=1 SV=2 1 135 4.0E-85
sp|P08903|H32_ENCAL Histone H3.2 OS=Encephalartos altensteinii PE=1 SV=2 1 135 4.0E-85
sp|P02301|H3C_MOUSE Histone H3.3C OS=Mus musculus GN=H3f3c PE=3 SV=3 1 135 8.0E-85
sp|Q402E1|H32_LILLO Histone H3.2 OS=Lilium longiflorum GN=YAH3 PE=1 SV=3 1 135 8.0E-85
sp|Q76MV0|H32_TOBAC Histone H3.2 OS=Nicotiana tabacum GN=B34 PE=1 SV=1 1 135 1.0E-84
sp|P69248|H32_PETCR Histone H3.2 OS=Petroselinum crispum GN=H3-7 PE=3 SV=2 1 135 1.0E-84
sp|Q2RAD9|H32_ORYSJ Histone H3.2 OS=Oryza sativa subsp. japonica GN=Os01g0866200 PE=3 SV=1 1 135 1.0E-84
sp|A2Y533|H32_ORYSI Histone H3.2 OS=Oryza sativa subsp. indica GN=OsI_019426 PE=2 SV=1 1 135 1.0E-84
sp|P69246|H32_MAIZE Histone H3.2 OS=Zea mays GN=H3C2 PE=1 SV=2 1 135 1.0E-84
sp|Q71T45|H32_EUPES Histone H3.2 OS=Euphorbia esula GN=H3 PE=2 SV=3 1 135 1.0E-84
sp|Q6LCK1|H32_BRANA Histone H3.2 OS=Brassica napus PE=2 SV=3 1 135 1.0E-84
sp|Q6LBE3|H32_ASPOF Histone H3.2 OS=Asparagus officinalis PE=2 SV=3 1 135 1.0E-84
sp|P59226|H32_ARATH Histone H3.2 OS=Arabidopsis thaliana GN=HTR2 PE=1 SV=2 1 135 1.0E-84
sp|P68428|H32_WHEAT Histone H3.2 OS=Triticum aestivum PE=1 SV=2 1 135 2.0E-84
sp|P68427|H32_PEA Histone H3.2 OS=Pisum sativum PE=1 SV=2 1 135 2.0E-84
sp|P68430|H32_ONOVI Histone H3.2 OS=Onobrychis viciifolia PE=2 SV=2 1 135 2.0E-84
sp|P68429|H32_MEDSA Histone H3.2 OS=Medicago sativa GN=H3-1.1 PE=1 SV=2 1 135 2.0E-84
sp|Q64400|H32_CRILO Histone H3.2 OS=Cricetulus longicaudatus PE=2 SV=3 1 135 2.0E-84
sp|P69079|H3_STRDR Histone H3, embryonic OS=Strongylocentrotus droebachiensis PE=2 SV=2 1 135 2.0E-84
sp|P69078|H3_SOLST Histone H3, embryonic OS=Solaster stimpsoni PE=2 SV=2 1 135 2.0E-84
sp|P69077|H3_PYCHE Histone H3, embryonic OS=Pycnopodia helianthoides PE=2 SV=2 1 135 2.0E-84
sp|P69076|H3_PSAMI Histone H3, embryonic OS=Psammechinus miliaris PE=2 SV=2 1 135 2.0E-84
sp|P69075|H3_PISOC Histone H3, embryonic OS=Pisaster ochraceus PE=2 SV=2 1 135 2.0E-84
sp|P69074|H3_PISBR Histone H3, embryonic OS=Pisaster brevispinus PE=2 SV=2 1 135 2.0E-84
sp|P69073|H3_PARLI Histone H3, embryonic OS=Paracentrotus lividus PE=2 SV=2 1 135 2.0E-84
sp|P69072|H3_LYTPI Histone H3, embryonic OS=Lytechinus pictus PE=2 SV=2 1 135 2.0E-84
sp|P69071|H3_DERIM Histone H3, embryonic OS=Dermasterias imbricata PE=2 SV=2 1 135 2.0E-84
sp|P06352|H3_STRPU Histone H3, embryonic OS=Strongylocentrotus purpuratus PE=1 SV=2 1 135 3.0E-84
sp|Q16695|H31T_HUMAN Histone H3.1t OS=Homo sapiens GN=HIST3H3 PE=1 SV=3 1 135 5.0E-84
sp|P0CO04|H3_CRYNJ Histone H3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HHT1 PE=3 SV=1 1 136 5.0E-84
sp|P0CO05|H3_CRYNB Histone H3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HHT1 PE=3 SV=1 1 136 5.0E-84
sp|A5PK61|H3C_BOVIN Histone H3.3C OS=Bos taurus GN=H3F3C PE=2 SV=1 1 135 7.0E-84
sp|Q71H73|H33_VITVI Histone H3.3 OS=Vitis vinifera PE=2 SV=3 1 135 7.0E-84
sp|Q76N23|H33_TOBAC Histone H3.3 OS=Nicotiana tabacum GN=H3 PE=1 SV=1 1 135 7.0E-84
sp|Q711T2|H33_PINPS Histone H3.3 OS=Pinus pinaster PE=2 SV=3 1 135 7.0E-84
sp|Q0JCT1|H33_ORYSJ Histone H3.3 OS=Oryza sativa subsp. japonica GN=H3 PE=1 SV=2 1 135 7.0E-84
sp|A2XHJ3|H33_ORYSI Histone H3.3 OS=Oryza sativa subsp. indica GN=OsI_011536 PE=3 SV=1 1 135 7.0E-84
sp|Q71U98|H33_ORYCO Histone H3.3 OS=Oryza coarctata PE=2 SV=3 1 135 7.0E-84
sp|P69244|H33_MEDSA Histone H3.3 OS=Medicago sativa PE=1 SV=2 1 135 7.0E-84
sp|P69245|H33_LOLTE Histone H3.3 OS=Lolium temulentum PE=2 SV=2 1 135 7.0E-84
sp|Q3C2E5|H33_LOLMU Histone H3.3 OS=Lolium multiflorum GN=RH3 PE=2 SV=3 1 135 7.0E-84
sp|Q71V89|H33_GOSHI Histone H3.3 OS=Gossypium hirsutum GN=HIS3 PE=2 SV=3 1 135 7.0E-84
sp|Q6RUR1|H33_CAPAN Histone H3.3 OS=Capsicum annuum PE=2 SV=3 1 135 7.0E-84
sp|P59169|H33_ARATH Histone H3.3 OS=Arabidopsis thaliana GN=HTR4 PE=1 SV=2 1 135 7.0E-84
sp|P22843|H3_ACRFO Histone H3 OS=Acropora formosa PE=3 SV=2 1 135 9.0E-84
sp|Q7XYZ0|H3_GRIJA Histone H3 OS=Griffithsia japonica PE=2 SV=3 1 136 2.0E-83
sp|P08898|H3_CAEEL Histone H3 OS=Caenorhabditis elegans GN=his-2 PE=1 SV=4 1 135 2.0E-83
sp|Q402E2|H33A_LILLO Histone H3.3a OS=Lilium longiflorum GN=MPH3 PE=2 SV=3 1 135 8.0E-83
sp|P02302|H3C_XENLA Histone H3.3C OS=Xenopus laevis GN=h3f3c PE=1 SV=2 1 135 1.0E-82
sp|P08437|H3_VOLCA Histone H3 OS=Volvox carteri GN=H3-I PE=3 SV=2 1 135 5.0E-81
sp|Q6LCW8|H32_CHLRE Histone H3 type 2 OS=Chlamydomonas reinhardtii GN=ch3-II PE=1 SV=1 1 135 5.0E-81
sp|Q6C0C4|H3_YARLI Histone H3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HHT1 PE=3 SV=1 1 134 6.0E-81
sp|Q9FKQ3|H3L5_ARATH Histone H3-like 5 OS=Arabidopsis thaliana GN=At5g65350 PE=2 SV=3 1 135 9.0E-81
sp|Q42681|H31_CHLRE Histone H3 type 1 OS=Chlamydomonas reinhardtii GN=ch3-I PE=1 SV=1 1 135 1.0E-80
sp|Q6NXT2|H3C_HUMAN Histone H3.3C OS=Homo sapiens GN=H3F3C PE=1 SV=3 1 135 2.0E-80
sp|Q9LR02|H3L3_ARATH Histone H3-like 3 OS=Arabidopsis thaliana GN=At1g75600 PE=2 SV=3 1 135 3.0E-80
sp|P50564|H33_CHLRE Histone H3 type 3 OS=Chlamydomonas reinhardtii GN=ch3-IV PE=1 SV=2 1 135 1.0E-79
sp|Q27532|H33L2_CAEEL Histone H3.3-like type 2 OS=Caenorhabditis elegans GN=his-74 PE=3 SV=3 1 136 1.0E-79
sp|P69150|H31_TETTH Histone H3 OS=Tetrahymena thermophila GN=HHT1 PE=1 SV=2 1 135 2.0E-79
sp|P69149|H31_TETPY Histone H3 OS=Tetrahymena pyriformis PE=1 SV=2 1 135 2.0E-79
sp|Q5MYA4|H32_CICIN Histone H3.2 OS=Cichorium intybus PE=2 SV=3 1 135 2.0E-79
sp|Q9FX60|H3L1_ARATH Histone H3-like 1 OS=Arabidopsis thaliana GN=At1g13370 PE=2 SV=3 1 135 1.0E-78
sp|P90543|H3_EUPCR Histone H3 OS=Euplotes crassus PE=3 SV=3 1 136 1.0E-77
sp|Q2Z2F4|H33B_LILLO Histone H3.3b OS=Lilium longiflorum GN=soH3-1 PE=2 SV=3 1 135 7.0E-77
sp|P06902|H3C_CAIMO Histone H3.3C OS=Cairina moschata GN=H3F3C PE=3 SV=2 1 135 5.0E-76
sp|P15512|H33_TETPY Histone H3.3 OS=Tetrahymena pyriformis PE=1 SV=2 1 135 5.0E-76
sp|P41353|H33_TETTS Histone H3.3 OS=Tetrahymena thermophila (strain SB210) GN=HHT3 PE=1 SV=2 1 135 9.0E-76
sp|Q9FXI7|H3L2_ARATH Histone H3-like 2 OS=Arabidopsis thaliana GN=MGH3 PE=2 SV=3 1 135 2.0E-75
sp|Q22RG7|H34_TETTS Histone H3.4 OS=Tetrahymena thermophila (strain SB210) GN=HHT4 PE=2 SV=1 1 135 3.0E-74
sp|Q55BN9|H33B_DICDI Histone H3.3 type b OS=Dictyostelium discoideum GN=H3b PE=1 SV=1 1 135 7.0E-74
sp|O15819|H33A_DICDI Histone H3.3 type a OS=Dictyostelium discoideum GN=H3a PE=1 SV=1 1 136 1.0E-73
sp|Q9U7D1|H3_MASBA Histone H3 OS=Mastigamoeba balamuthi PE=2 SV=1 1 135 5.0E-72
sp|Q27489|H33L3_CAEEL Putative histone H3.3-like type 3 OS=Caenorhabditis elegans GN=his-69 PE=5 SV=1 13 136 9.0E-69
sp|Q55BP0|H33C_DICDI Histone H3.3 type c OS=Dictyostelium discoideum GN=H3c PE=1 SV=1 1 135 1.0E-66
sp|Q27490|H33L1_CAEEL Histone H3.3-like type 1 OS=Caenorhabditis elegans GN=his-70 PE=3 SV=4 1 136 5.0E-64
sp|Q98RY4|H3_GUITH Histone H3 OS=Guillardia theta PE=3 SV=3 1 134 4.0E-63
sp|P81198|H34_STYLE Histone H3-4 (Fragment) OS=Stylonychia lemnae GN=H3-4 PE=3 SV=1 12 120 3.0E-62
sp|Q9LXU8|H3L4_ARATH Histone H3-like 4 OS=Arabidopsis thaliana GN=At5g12910 PE=2 SV=3 1 135 2.0E-60
sp|P81199|H35_STYLE Histone H3-5 (Fragment) OS=Stylonychia lemnae GN=H3-5 PE=3 SV=1 11 120 2.0E-59
sp|P81195|H31_STYLE Histone H3-1 (Fragment) OS=Stylonychia lemnae GN=H3-1 PE=3 SV=1 11 120 4.0E-59
sp|P81202|H38_STYLE Histone H3-8 (Fragment) OS=Stylonychia lemnae GN=H3-8 PE=3 SV=1 11 120 9.0E-59
sp|P81200|H36_STYLE Histone H3-6 (Fragment) OS=Stylonychia lemnae GN=H3-6 PE=3 SV=1 11 120 7.0E-56
sp|P81197|H33_STYLE Histone H3-3 (Fragment) OS=Stylonychia lemnae GN=H3-3 PE=3 SV=1 11 120 8.0E-56
sp|P81196|H39_STYLE Histone H3-2 (Fragment) OS=Stylonychia lemnae GN=H3-2 PE=3 SV=1 11 120 2.0E-54
sp|P81201|H37_STYLE Histone H3-7 (Fragment) OS=Stylonychia lemnae GN=H3-7 PE=3 SV=1 11 120 2.0E-54
sp|Q3SZB8|H3CL_BOVIN Histone H3.3C-like OS=Bos taurus PE=2 SV=3 1 116 2.0E-51
sp|Q8SS77|H31_ENCCU Histone H3.1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HHT1 PE=3 SV=3 1 132 6.0E-50
sp|Q06196|H3_ENTHI Histone H3 OS=Entamoeba histolytica GN=H3 PE=3 SV=2 1 136 6.0E-47
sp|Q2Z2F6|H3L3_LILLO Histone H3-like 3 OS=Lilium longiflorum GN=leH3 PE=2 SV=3 1 133 1.0E-46
sp|P40285|H3_LEIIN Histone H3 OS=Leishmania infantum PE=2 SV=1 1 136 1.0E-44
sp|P06353|H33_HORVU Histone H3.3 (Fragment) OS=Hordeum vulgare PE=2 SV=1 57 135 1.0E-42
sp|Q59LN9|CENPA_CANAL Histone H3-like centromeric protein CSE4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CSE4 PE=3 SV=1 36 134 1.0E-41
sp|Q7RXR3|CENPA_NEUCR Histone H3-like centromeric protein hH3v OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hH3v PE=3 SV=1 41 133 2.0E-41
sp|Q0MXD1|CENPA_MILFA Histone H3-like centromeric protein CSE4 OS=Millerozyma farinosa GN=CSE4 PE=3 SV=1 41 134 1.0E-40
sp|Q8SQP3|H3L_ENCCU Histone H3-like protein OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_0450 PE=3 SV=1 1 132 7.0E-40
sp|Q9Y812|CENPA_SCHPO Histone H3-like centromeric protein cnp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cnp1 PE=1 SV=1 41 133 7.0E-40
sp|Q6CER9|CENPA_YARLI Histone H3-like centromeric protein CSE4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CSE4 PE=3 SV=1 10 133 2.0E-38
sp|Q803H4|CENPA_DANRE Histone H3-like centromeric protein A OS=Danio rerio GN=cenpa PE=1 SV=1 22 133 2.0E-38
sp|Q75DE4|CENPA_ASHGO Histone H3-like centromeric protein CSE4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CSE4 PE=3 SV=2 37 134 4.0E-36
sp|Q28I31|CENPA_XENTR Histone H3-like centromeric protein A OS=Xenopus tropicalis GN=cenpa PE=2 SV=1 41 133 1.0E-34
sp|Q569M3|CENPA_XENLA Histone H3-like centromeric protein A OS=Xenopus laevis GN=cenpa PE=2 SV=1 41 133 4.0E-34
sp|Q0MTC0|CENPA_KLUMA Histone H3-like centromeric protein CSE4 OS=Kluyveromyces marxianus GN=CSE4 PE=3 SV=1 41 134 8.0E-34
sp|P36012|CENPA_YEAST Histone H3-like centromeric protein CSE4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSE4 PE=1 SV=2 41 134 2.0E-33
sp|Q6CTI2|CENPA_KLULA Histone H3-like centromeric protein CSE4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CSE4 PE=1 SV=1 41 134 3.0E-33
sp|Q2N2K6|CENPA_TETTS Histone H3-like centromeric protein CNA1 OS=Tetrahymena thermophila (strain SB210) GN=CNA1 PE=3 SV=1 41 136 2.0E-30
sp|Q874J6|CENPA_CANGA Histone H3-like centromeric protein CSE4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CSE4 PE=3 SV=1 37 134 2.0E-30
sp|Q0MXD0|CENPA_KAZSE Histone H3-like centromeric protein CSE4 OS=Kazachstania servazzii GN=CSE4 PE=3 SV=1 41 134 1.0E-29
sp|P34470|HCP3_CAEEL Histone H3-like centromeric protein hcp-3 OS=Caenorhabditis elegans GN=hcp-3 PE=1 SV=1 36 131 1.0E-28
sp|Q6XXM1|CENPA_CHICK Histone H3-like centromeric protein A OS=Gallus gallus GN=CENPA PE=1 SV=1 45 133 4.0E-28
sp|Q8RVQ9|HTR12_ARATH Histone H3-like centromeric protein HTR12 OS=Arabidopsis thaliana GN=HTR12 PE=1 SV=3 22 134 1.0E-27
sp|P34440|HCP3L_CAEEL Histone H3-like centromeric protein cpar-1 OS=Caenorhabditis elegans GN=cpar-1 PE=1 SV=1 36 131 1.0E-26
sp|P49450|CENPA_HUMAN Histone H3-like centromeric protein A OS=Homo sapiens GN=CENPA PE=1 SV=1 9 133 2.0E-26
sp|Q8R565|CENPA_CRIGR Histone H3-like centromeric protein A OS=Cricetulus griseus GN=CENPA PE=2 SV=1 47 133 1.0E-25
sp|O35216|CENPA_MOUSE Histone H3-like centromeric protein A OS=Mus musculus GN=Cenpa PE=2 SV=1 15 133 1.0E-23
sp|P49449|CENPA_BOVIN Histone H3-like centromeric protein A OS=Bos taurus GN=CENPA PE=1 SV=3 48 133 1.0E-23
sp|A8XA80|HCP3L_CAEBR Histone H3-like centromeric protein cpar-1 OS=Caenorhabditis briggsae GN=cpar-1 PE=3 SV=1 36 131 4.0E-23
sp|Q9MBF6|H3L1_LILLO Histone H3-like 1 OS=Lilium longiflorum GN=gH3 PE=2 SV=3 46 134 5.0E-22
sp|Q9XG57|H3L2_LILLO Histone H3-like 2 OS=Lilium longiflorum GN=gcH3 PE=2 SV=3 1 100 1.0E-20
sp|P69127|H32_TETTR Histone H3.2 (Fragment) OS=Tetrahymena tropicalis PE=3 SV=2 1 41 1.0E-17
sp|P69126|H32_TETSO Histone H3.2 (Fragment) OS=Tetrahymena sonneborni PE=3 SV=2 1 41 1.0E-17
sp|P69125|H32_TETRO Histone H3.2 (Fragment) OS=Tetrahymena rostrata PE=3 SV=2 1 41 1.0E-17
sp|P69122|H32_TETPR Histone H3.2 (Fragment) OS=Tetrahymena paravorax PE=3 SV=2 1 41 1.0E-17
sp|P69124|H32_TETPI Histone H3.2 (Fragment) OS=Tetrahymena pigmentosa PE=3 SV=2 1 41 1.0E-17
sp|P69123|H32_TETPA Histone H3.2 (Fragment) OS=Tetrahymena patula PE=3 SV=2 1 41 1.0E-17
sp|P69121|H32_TETNI Histone H3.2 (Fragment) OS=Tetrahymena nipissingi PE=3 SV=2 1 41 1.0E-17
sp|P69120|H32_TETNA Histone H3.2 (Fragment) OS=Tetrahymena nanneyi PE=3 SV=2 1 41 1.0E-17
sp|P69119|H32_TETMI Histone H3.2 (Fragment) OS=Tetrahymena mimbres PE=3 SV=2 1 41 1.0E-17
sp|P69118|H32_TETMA Histone H3.2 (Fragment) OS=Tetrahymena malaccensis PE=3 SV=2 1 41 1.0E-17
sp|P69117|H32_TETLE Histone H3.2 (Fragment) OS=Tetrahymena leucophrys PE=3 SV=2 1 41 1.0E-17
sp|P69116|H32_TETHY Histone H3.2 (Fragment) OS=Tetrahymena hyperangularis PE=3 SV=2 1 41 1.0E-17
sp|P69115|H32_TETFU Histone H3.2 (Fragment) OS=Tetrahymena furgasoni PE=3 SV=2 1 41 1.0E-17
sp|P69114|H32_TETEL Histone H3.2 (Fragment) OS=Tetrahymena elliotti PE=3 SV=2 1 41 1.0E-17
sp|P69113|H32_TETCU Histone H3.2 (Fragment) OS=Tetrahymena caudata PE=3 SV=2 1 41 1.0E-17
sp|P69112|H32_TETCA Histone H3.2 (Fragment) OS=Tetrahymena capricornis PE=3 SV=2 1 41 1.0E-17
sp|P69111|H32_TETAU Histone H3.2 (Fragment) OS=Tetrahymena australis PE=3 SV=2 1 41 1.0E-17
sp|P69110|H32_TETAM Histone H3.2 (Fragment) OS=Tetrahymena americanis PE=3 SV=2 1 41 1.0E-17
sp|P17319|H32_TETBO Histone H3.2 (Fragment) OS=Tetrahymena borealis PE=3 SV=2 1 41 2.0E-16
sp|P83864|H3_LITVA Histone H3 (Fragments) OS=Litopenaeus vannamei PE=1 SV=1 38 84 2.0E-13
sp|Q54F38|H3V1_DICDI Histone H3.v1 OS=Dictyostelium discoideum GN=H3v1 PE=3 SV=1 52 132 6.0E-13
sp|Q9V6Q2|CID_DROME Histone H3-like centromeric protein cid OS=Drosophila melanogaster GN=cid PE=1 SV=2 50 127 1.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4919
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3323
Ophiocordyceps australis map64 (Brazil) OphauB2|2492
Ophiocordyceps camponoti-floridani Ophcf2|03256
Ophiocordyceps camponoti-rufipedis Ophun1|1525 (this protein)
Ophiocordyceps kimflemingae Ophio5|1265
Ophiocordyceps subramaniannii Hirsu2|1541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1525
MARTKQTARKSTGGKAPRKQLASKAARKSAPSTGGVKKPHRYKPGTVALREIRRYQKSTELLIRKLPFQRLVREI
AQDFKSDLRFQSSAIGALQESVESYLVSLFEDTNLCAIHAKRVTIQSKDIQLARRLRGERN*
Coding >Ophun1|1525
ATGGCTCGCACGAAGCAAACAGCTCGCAAGTCCACTGGTGGCAAAGCACCTCGGAAGCAACTGGCTTCCAAGGCT
GCCAGGAAGAGTGCCCCGTCTACGGGTGGTGTCAAGAAGCCTCATCGCTACAAGCCTGGTACTGTCGCCCTTCGA
GAGATTCGCCGCTACCAGAAATCGACGGAGCTGTTGATTCGCAAGCTTCCCTTCCAGCGACTGGTCCGCGAAATT
GCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCGGCTATCGGTGCTCTCCAGGAGTCAGTGGAGTCCTAC
CTCGTGTCTCTGTTTGAGGACACGAATCTCTGCGCCATTCATGCCAAGCGTGTGACAATCCAGTCGAAGGACATC
CAGCTCGCTAGGCGGTTGCGTGGGGAGCGGAATTAG
Transcript >Ophun1|1525
ATGGCTCGCACGAAGCAAACAGCTCGCAAGTCCACTGGTGGCAAAGCACCTCGGAAGCAACTGGCTTCCAAGGCT
GCCAGGAAGAGTGCCCCGTCTACGGGTGGTGTCAAGAAGCCTCATCGCTACAAGCCTGGTACTGTCGCCCTTCGA
GAGATTCGCCGCTACCAGAAATCGACGGAGCTGTTGATTCGCAAGCTTCCCTTCCAGCGACTGGTCCGCGAAATT
GCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCGGCTATCGGTGCTCTCCAGGAGTCAGTGGAGTCCTAC
CTCGTGTCTCTGTTTGAGGACACGAATCTCTGCGCCATTCATGCCAAGCGTGTGACAATCCAGTCGAAGGACATC
CAGCTCGCTAGGCGGTTGCGTGGGGAGCGGAATTAG
Gene >Ophun1|1525
ATGGCTCGCACGAAGCAAACAGCTCGCAAGTCCACTGGTGGCAAAGCACCTCGGAAGCAACTGGCTTCCAAGGCT
GGTATGTTCACGACTAGCCATCGCTGCCTCCCATCATCTCTCGCTAACCATGCTCAGCCAGGAAGAGTGCCCCGT
CTACGGGTGGTGTCAAGAAGCCTCATCGCTACAAGCCTGGTACTGTCGCCCTTCGAGAGATTCGCCGCTACCAGA
AATCGACGGAGCTGTTGATTCGCAAGCTTCCCTTCCAGCGACTGGTGAGTGCCGCGTATTCAGATTTTTTGAACG
CGCTAACCCCTCTCACAGGTCCGCGAAATTGCTCAGGATTTCAAGAGCGACTTGCGCTTCCAGTCATCGGCTATC
GGTGCTCTCCAGGAGTCAGTGGAGTCCTACCTCGTGTCTCTGTTTGAGGACACGAATCTCTGCGCCATTCATGCC
AAGCGTGTGACAATCCAGTCGAAGGACATCCAGCTCGCTAGGCGGTTGCGTGGGGAGCGGAATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail