Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1509
Gene name
LocationContig_1618:142..724
Strand+
Gene length (bp)582
Transcript length (bp)402
Coding sequence length (bp)402
Protein length (aa) 134

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08570 DUF1761 Protein of unknown function (DUF1761) 7.6E-23 7 122

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTI9|YKZ2_SCHPO UPF0591 membrane protein C15E1.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC15E1.02c PE=3 SV=1 11 128 2.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 41 63 22
2 73 95 22
3 104 126 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1509
MSLHCNIELAVLSPIFGKTYQRAKQANTKEEFIRSSEAAGAAAAWGTSFVGAALQSYGVGALINATGTLSYKGAA
YLGGLIFTATSMPTYLAQVFTEKRPLDTVGVSIAAKLCETIGLSLFLTWWGTRTNPFD*
Coding >Ophun1|1509
ATGTCTCTGCACTGCAACATCGAGCTGGCCGTCCTCTCCCCCATCTTCGGAAAAACCTACCAGCGCGCCAAGCAG
GCCAACACAAAGGAAGAGTTCATCCGCTCCAGCGAGGCTGCCGGCGCCGCCGCCGCCTGGGGCACCTCGTTCGTC
GGCGCCGCCTTGCAGTCGTACGGCGTCGGCGCCCTCATCAATGCCACCGGCACCTTGAGCTACAAGGGCGCTGCT
TACCTCGGCGGCCTCATCTTTACCGCTACGTCCATGCCCACGTATTTGGCTCAGGTCTTCACTGAAAAGAGGCCT
CTTGATACCGTGGGCGTCAGCATCGCCGCCAAGCTTTGCGAGACTATCGGCCTCTCGCTCTTCTTGACCTGGTGG
GGGACGCGTACGAATCCCTTTGACTAG
Transcript >Ophun1|1509
ATGTCTCTGCACTGCAACATCGAGCTGGCCGTCCTCTCCCCCATCTTCGGAAAAACCTACCAGCGCGCCAAGCAG
GCCAACACAAAGGAAGAGTTCATCCGCTCCAGCGAGGCTGCCGGCGCCGCCGCCGCCTGGGGCACCTCGTTCGTC
GGCGCCGCCTTGCAGTCGTACGGCGTCGGCGCCCTCATCAATGCCACCGGCACCTTGAGCTACAAGGGCGCTGCT
TACCTCGGCGGCCTCATCTTTACCGCTACGTCCATGCCCACGTATTTGGCTCAGGTCTTCACTGAAAAGAGGCCT
CTTGATACCGTGGGCGTCAGCATCGCCGCCAAGCTTTGCGAGACTATCGGCCTCTCGCTCTTCTTGACCTGGTGG
GGGACGCGTACGAATCCCTTTGACTAG
Gene >Ophun1|1509
ATGTCTCTGCACTGCAAGTCGCCCCCATTCACCTCCATCCACCTCCATCCACCCATCAACAGCTAACAAACCCCC
CCCCCTTCCCCTAGACCTCCCCCCCGTCAAACCCTCGGCCATCGCCGTCGGCCTCGCCTTCAACCAGAGCATCGA
GCTGGCCGTCCTCTCCCCCATCTTCGGAAAAACCTACCAGCGCGCCAAGCAGGCCAACACAAAGGAAGAGTTCAT
CCGCTCCAGCGAGGCTGCCGGCGCCGCCGCCGCCTGGGGCACCTCGTTCGTCGGCGCCGCCTTGCAGTCGTACGG
CGTCGGCGCCCTCATCAATGCCACCGGCACCTTGAGCTACAAGGGCGCTGCTTACCTCGGCGGCCTCATCTTTAC
CGCTACGTCCATGCCCACGGTGAGTTGTCCGCTGTCGCTGGCTCTGGGGACTTGCTGATGGGTCGTCTGCAGTAT
TTGGCTCAGGTCTTCACTGAAAAGAGGCCTCTTGATACCGTGGGCGTCAGCATCGCCGCCAAGCTTTGCGAGACT
ATCGGCCTCTCGCTCTTCTTGACCTGGTGGGGGACGCGTACGAATCCCTTTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail