Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1508
Gene name
LocationContig_1612:891..1707
Strand+
Gene length (bp)816
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16893 fn3_2 Fibronectin type III domain 2.2E-37 75 162
PF16892 CHS5_N Chitin biosynthesis protein CHS5 N-terminus 7.2E-24 3 49
PF12738 PTCB-BRCT twin BRCT domain 4.1E-11 175 233
PF00533 BRCT BRCA1 C Terminus (BRCT) domain 3.0E-07 164 233

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92357|CFR1_SCHPO Cell fusion protein cfr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cfr1 PE=3 SV=1 5 233 8.0E-68
sp|O74161|CHS5_CANAL Chitin biosynthesis protein CHS5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHS5 PE=3 SV=2 3 233 8.0E-63
sp|Q12114|CHS5_YEAST Chitin biosynthesis protein CHS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS5 PE=1 SV=1 3 233 6.0E-60

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5798
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1640
Ophiocordyceps australis map64 (Brazil) OphauB2|7393
Ophiocordyceps camponoti-floridani Ophcf2|06177
Ophiocordyceps camponoti-rufipedis Ophun1|1508 (this protein)
Ophiocordyceps kimflemingae Ophio5|7732
Ophiocordyceps subramaniannii Hirsu2|986

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1508
MLVSLTVGKVDAGVTVLLTPDKRLIEFPSILLPPNISSGSIVDITVSQNSSKESAEEQKFRGLQERIYSSFGASE
PETPCLRCRNATQTSVVLEWDPVQLATADLISLSLYRNGQKAGNIPRPLEMHSTKISGLAVDTAYTFHLVLRTSA
GTRMSEKVAVRTHKMTDLSGITITTGILAAAAREKLAQAVERIGAKMVEGVRIDTTHFVTTEGRGPAWEKAVEGN
IPVVRPDFTSML*
Coding >Ophun1|1508
ATGCTCGTCTCCCTCACCGTCGGCAAAGTCGACGCCGGCGTCACCGTCCTCCTCACCCCCGACAAGCGCCTCATC
GAGTTCCCATCCATTCTCCTCCCCCCCAACATCTCCTCCGGCAGCATCGTCGACATCACCGTCTCGCAAAACAGC
AGCAAAGAATCAGCCGAAGAGCAAAAGTTCAGAGGTCTGCAGGAGCGCATCTACAGCTCGTTCGGAGCTTCCGAA
CCCGAAACACCTTGCCTACGATGCCGCAACGCGACGCAGACGTCTGTCGTGCTCGAGTGGGATCCCGTGCAGCTG
GCGACGGCGGACCTGATATCGCTCAGCCTCTACCGCAACGGGCAGAAGGCAGGCAACATCCCCCGTCCGCTGGAG
ATGCACAGCACAAAGATAAGCGGTCTGGCCGTCGACACGGCGTATACCTTTCACCTGGTCCTCAGGACGAGCGCC
GGCACGCGCATGAGCGAAAAGGTGGCGGTGCGGACGCACAAGATGACGGACCTGAGCGGCATCACCATCACGACG
GGCATCCTGGCCGCGGCTGCGAGGGAGAAGTTGGCGCAGGCGGTGGAGAGGATTGGGGCCAAGATGGTCGAGGGC
GTGAGGATCGACACGACGCATTTCGTTACGACGGAGGGGAGGGGGCCTGCTTGGGAGAAGGCGGTTGAGGGGAAT
ATTCCCGTGGTGAGGCCTGATTTTACCTCGATGCTATGA
Transcript >Ophun1|1508
ATGCTCGTCTCCCTCACCGTCGGCAAAGTCGACGCCGGCGTCACCGTCCTCCTCACCCCCGACAAGCGCCTCATC
GAGTTCCCATCCATTCTCCTCCCCCCCAACATCTCCTCCGGCAGCATCGTCGACATCACCGTCTCGCAAAACAGC
AGCAAAGAATCAGCCGAAGAGCAAAAGTTCAGAGGTCTGCAGGAGCGCATCTACAGCTCGTTCGGAGCTTCCGAA
CCCGAAACACCTTGCCTACGATGCCGCAACGCGACGCAGACGTCTGTCGTGCTCGAGTGGGATCCCGTGCAGCTG
GCGACGGCGGACCTGATATCGCTCAGCCTCTACCGCAACGGGCAGAAGGCAGGCAACATCCCCCGTCCGCTGGAG
ATGCACAGCACAAAGATAAGCGGTCTGGCCGTCGACACGGCGTATACCTTTCACCTGGTCCTCAGGACGAGCGCC
GGCACGCGCATGAGCGAAAAGGTGGCGGTGCGGACGCACAAGATGACGGACCTGAGCGGCATCACCATCACGACG
GGCATCCTGGCCGCGGCTGCGAGGGAGAAGTTGGCGCAGGCGGTGGAGAGGATTGGGGCCAAGATGGTCGAGGGC
GTGAGGATCGACACGACGCATTTCGTTACGACGGAGGGGAGGGGGCCTGCTTGGGAGAAGGCGGTTGAGGGGAAT
ATTCCCGTGGTGAGGCCTGATTTTACCTCGATGCTATGA
Gene >Ophun1|1508
ATGCTCGTCTCCCTCACCGTCGGCAAAGTCGACGCCGGCGTCACCGTCCTCCTCACCCCCGACAAGCGCCTCGTA
CGCATCCTCACCACCTTCTAACCCCCCCTCCCCCACGCTGACGGCCTCAGATCGAGTTCCCATCCATTCTCCTCC
CCCCCAACATCTCCTCCGGCAGCATCGTCGACATCACCGTCTCGCAAAACAGCAGCAAAGAATCAGCCGAAGAGC
AAAAGTTCAGAGGTCTGCAGGAGCGCATCTACAGCTCGTTCGGAGCTTCCGAACCCGAAACACCTTGCCTACGAT
GCCGCAACGCGACGCAGACGTCTGTCGTGCTCGAGTGGGATCCCGTGCAGCTGGCGACGGCGGACCTGATATCGC
TCAGCCTCTACCGCAACGGGCAGAAGGCAGGCAACATCCCCCGTCCGCTGGAGATGCACAGCACAAAGATAAGCG
GTCTGGCCGTCGACACGGCGTATACCTTTCACCTGGTCCTCAGGACGAGCGCCGGCACGCGCATGAGCGAAAAGG
TGGCGGTGCGGACGCACAAGATGACGGACCTGAGCGGCATCACCATCACGACGGGCATCCTGGCCGCGGCTGCGA
GGGAGAAGTTGGCGCAGGCGGTGGAGAGGATTGGGGCCAAGATGGTCGAGGGCGTGAGGATCGACACGACGCATT
TCGTTACGACGGAGGGGAGGGGGCCTGCTTGGGAGAAGGCGGTTGAGGGGAATATTCCCGTGGTGAGGCCTGAGT
GGGTGGAGGCTTGTGAGAGTAACGGCCGCATCCTCGGCGTGACCAAGTTTTACCTCGATGCTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail