Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1503
Gene name
LocationContig_161:18883..22365
Strand-
Gene length (bp)3482
Transcript length (bp)3426
Coding sequence length (bp)3426
Protein length (aa) 1142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11707 Npa1 Ribosome 60S biogenesis N-terminal 5.0E-93 98 440
PF16201 NopRA1 Nucleolar pre-ribosomal-associated protein 1 4.9E-58 896 1087

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74415|YJL2_SCHPO Uncharacterized protein C14G10.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC14G10.02 PE=4 SV=1 150 772 5.0E-40
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 100 783 2.0E-35
sp|P34241|URB1_YEAST Nucleolar pre-ribosomal-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URB1 PE=1 SV=2 924 1089 3.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1503
MGKRPSSGVDGPTAPRKRQRITIDAPAGEDISSSDHLRSLLAFDQDLRKARHGLQSLKKLLDDIISDHANRRDKV
GILQQYLDAGKPRDAGEDAIYLRDIMDMWSLAVQVNDDGVMSSVAVVLALLLSVVSQSLQLVPHGLGICQTLLQE
RQLKLLSKNLASDNRKAFIISPTLRLLREAVCLDGGAYAKAIVRAGTYTFSSLARNLELGNSVPGTEDAGKSSIR
TNAVRFFLSCLKHVSSQGRKELLSQRHLISRLTYSIKTDPPHVALEILDALQSHVLMDPKIPRDVKFRNFNIRTL
LRLLALYGLPGGDSDEGNPVSDRAHEFLMYACTSPDAGILFPYRGLYPKESGDEQSDDKAARQVGSQPGGSQAAH
ENQDLPVHNFALSEFAAKLRPWASTRQSQLLVAMFEAAPELIAHYFHDNRFFTFEPKVSMTWVGYAAFLFDTISI
TLRPSFGDPVHYADGPPPAAVLLDNILPPAITQKVLVRCFSPKSDVTALFATKILVAALEKLATALKMLDPAQAR
KDAKWSEAARRLEDAFCQRVPEMKEIVLCYKGISKENSMHRTLASRLLLLYYRVIPRVALAANFDVSPLLTAVLE
GLRQEEDEPGTRQLSLIELEGLVTIASYSPGMRWFSRFEGPRRESSTSAFVALLKLLCGGDDDTPFRHLKEALAG
VAGESQLVSKSTGLKPLLATLQLTVTRADTGDMETVWAFLDNCIGRCVASPIKYIEILETLSVEQTDAPPAVEDD
GSLSLLSLALVEQLPFAVKSGDKKSIKPLARFLSLYFNACYRWEGRGEVIKALHQQSRCTLSKTKVKMTTLGESS
DLTALKATESASDTDRDSSGAKEGQPKKPGELDLHQELHVPPLDEGDAAVLAKCISKTLEDVIEDGWVVKLVRLL
LSEHTHIRKEALTGILKVAARVKDSALEERSQIWLLLSELAESSRSQIESGPVPSAFVAFAMHALDVVQSPLHPL
YPKLNRYLTRSPMWPPDKLPLAHDILHGEPSEDDKYYTEIAWLLDYLLDSLRTQRDMDVFHGKKWLEKLLALGSN
PYLRTGLRTRLLKLVYRASCIQGGSTTLVTRFGVLSWLHGQQAAADAADEAAVCERLMRRVWDTCDHHRVSAWSH
GGAQTLVRGVAREGAR*
Coding >Ophun1|1503
ATGGGCAAGAGACCCTCTTCCGGCGTCGACGGTCCGACCGCGCCTCGCAAGCGGCAACGGATAACCATCGACGCC
CCGGCCGGTGAAGACATCTCTTCCAGCGACCATTTGCGAAGCTTGCTAGCCTTTGACCAGGACCTTCGCAAGGCG
CGGCACGGTCTTCAATCCTTGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTC
GGCATCCTCCAACAATACCTCGATGCCGGTAAACCAAGGGATGCCGGTGAAGATGCCATCTACCTCCGCGACATC
ATGGACATGTGGTCTCTCGCTGTTCAGGTCAACGATGACGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTA
CTTCTGAGCGTCGTCTCCCAGTCCTTGCAGTTGGTGCCTCATGGCCTTGGAATTTGCCAGACACTCCTTCAGGAA
AGGCAACTAAAGCTGTTATCCAAAAACTTGGCTTCTGATAACCGGAAAGCCTTTATCATCTCCCCTACGCTGCGT
TTGCTGCGGGAAGCTGTTTGCCTGGATGGCGGTGCCTACGCCAAGGCCATCGTCCGAGCTGGCACCTATACCTTC
TCCTCTCTGGCCCGGAATCTGGAGCTTGGAAACTCAGTTCCAGGAACCGAGGATGCTGGCAAATCATCAATCAGG
ACGAATGCCGTCCGCTTCTTTCTGAGCTGTCTCAAACACGTCAGCTCGCAGGGCCGAAAGGAGCTCCTTTCGCAG
AGACACCTTATCTCTCGACTGACGTACTCCATCAAAACCGATCCGCCGCACGTCGCCTTGGAAATACTAGACGCA
CTTCAGTCACATGTGCTCATGGATCCCAAGATACCGCGCGATGTCAAGTTTCGCAACTTCAACATCAGGACACTG
CTGAGACTACTGGCCCTCTATGGGCTGCCAGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCAC
GAGTTTCTCATGTACGCTTGCACGTCGCCGGATGCTGGAATCCTATTCCCTTACAGGGGTCTTTACCCGAAGGAG
TCCGGCGACGAACAATCGGACGACAAAGCCGCCAGACAGGTCGGAAGCCAACCCGGAGGCAGTCAGGCCGCTCAT
GAGAATCAAGACCTTCCTGTACACAATTTCGCCCTGTCCGAGTTTGCCGCAAAGCTTCGCCCGTGGGCCAGCACG
AGACAGAGTCAACTTCTGGTGGCCATGTTTGAGGCCGCCCCAGAACTCATTGCCCACTACTTTCACGACAACCGA
TTTTTTACCTTTGAGCCCAAGGTGTCCATGACCTGGGTCGGATACGCCGCCTTCCTCTTCGACACCATCAGCATC
ACCCTCCGTCCTTCGTTTGGGGACCCTGTGCACTATGCTGACGGCCCTCCTCCCGCGGCCGTTCTGCTGGATAAC
ATCCTCCCCCCCGCCATCACTCAGAAAGTCCTCGTCCGATGTTTTTCGCCAAAGTCGGACGTGACGGCACTTTTT
GCCACAAAGATCCTCGTCGCCGCTCTGGAGAAGCTTGCCACGGCCCTCAAGATGCTGGATCCGGCGCAAGCTCGA
AAGGACGCCAAGTGGTCGGAAGCGGCCCGGCGGCTCGAGGATGCCTTTTGTCAGCGGGTGCCCGAAATGAAGGAA
ATCGTCCTATGTTACAAGGGGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTGCTGCTC
TACTACCGAGTGATCCCTCGAGTGGCTCTGGCCGCCAACTTTGATGTCTCGCCCTTGCTCACAGCTGTGCTGGAA
GGGCTGCGGCAAGAGGAGGATGAGCCTGGGACCCGACAACTCAGCCTCATTGAGTTGGAGGGCCTCGTGACTATA
GCCAGTTACTCGCCTGGTATGAGGTGGTTTTCCAGATTCGAAGGCCCGCGTCGTGAATCTTCAACCTCGGCGTTC
GTCGCCCTGCTTAAGCTTCTCTGTGGCGGTGACGACGATACTCCCTTTCGTCACCTCAAAGAAGCGTTGGCTGGC
GTTGCCGGGGAGAGCCAACTCGTCTCCAAGTCGACAGGCTTGAAACCACTGCTGGCGACCCTGCAACTCACCGTC
ACTCGGGCTGACACGGGGGACATGGAAACGGTATGGGCTTTCTTGGATAATTGCATAGGCCGCTGCGTCGCCTCT
CCGATCAAGTACATCGAAATCTTAGAGACCCTCTCGGTTGAGCAGACTGATGCTCCGCCGGCAGTGGAAGACGAC
GGATCGCTGTCATTGCTCAGCCTCGCACTGGTGGAGCAGCTGCCATTTGCCGTGAAATCCGGCGACAAGAAGAGC
ATCAAGCCTCTCGCGCGATTTCTCTCACTCTACTTCAACGCGTGTTATCGCTGGGAGGGTCGCGGCGAAGTCATC
AAGGCTCTTCATCAACAATCGCGCTGTACATTGTCAAAGACCAAAGTCAAGATGACCACTTTGGGAGAAAGCAGC
GATTTGACGGCCCTGAAAGCGACAGAGTCTGCTTCCGACACTGATCGTGATTCCTCCGGCGCCAAGGAGGGACAG
CCCAAAAAGCCGGGCGAGTTGGATCTGCATCAAGAGCTCCACGTTCCCCCCTTGGACGAGGGTGACGCGGCAGTC
CTCGCGAAATGCATCTCGAAGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGTACGACTCTTG
TTATCGGAGCATACGCACATCCGCAAAGAGGCTCTCACCGGCATCCTTAAAGTAGCAGCCCGCGTCAAGGACTCG
GCACTCGAGGAACGCTCGCAGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGTCACAGATTGAGTCA
GGCCCCGTCCCATCAGCTTTCGTGGCCTTCGCCATGCACGCCCTCGACGTGGTGCAGAGTCCATTGCATCCGCTG
TATCCGAAACTGAACCGCTACCTCACCCGCAGCCCCATGTGGCCGCCGGACAAGCTGCCGCTCGCCCACGACATC
CTCCACGGCGAGCCGTCAGAGGACGACAAGTACTACACCGAGATCGCCTGGCTCCTCGACTATCTCCTCGACAGC
CTGCGGACGCAGCGCGACATGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGTTGGCGCTCGGAAGCAAC
CCCTACCTCAGGACCGGGCTGCGCACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGTTGCATCCAAGGCGGCAGC
ACCACCCTCGTCACCAGGTTCGGCGTCCTCAGCTGGCTCCATGGACAACAAGCGGCAGCCGATGCGGCCGACGAG
GCTGCTGTTTGCGAGCGTCTGATGCGCCGCGTATGGGACACGTGTGACCACCATCGCGTTTCTGCCTGGAGCCAT
GGCGGCGCGCAGACGCTCGTCCGAGGAGTGGCCCGCGAAGGAGCGCGCTGA
Transcript >Ophun1|1503
ATGGGCAAGAGACCCTCTTCCGGCGTCGACGGTCCGACCGCGCCTCGCAAGCGGCAACGGATAACCATCGACGCC
CCGGCCGGTGAAGACATCTCTTCCAGCGACCATTTGCGAAGCTTGCTAGCCTTTGACCAGGACCTTCGCAAGGCG
CGGCACGGTCTTCAATCCTTGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTC
GGCATCCTCCAACAATACCTCGATGCCGGTAAACCAAGGGATGCCGGTGAAGATGCCATCTACCTCCGCGACATC
ATGGACATGTGGTCTCTCGCTGTTCAGGTCAACGATGACGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTA
CTTCTGAGCGTCGTCTCCCAGTCCTTGCAGTTGGTGCCTCATGGCCTTGGAATTTGCCAGACACTCCTTCAGGAA
AGGCAACTAAAGCTGTTATCCAAAAACTTGGCTTCTGATAACCGGAAAGCCTTTATCATCTCCCCTACGCTGCGT
TTGCTGCGGGAAGCTGTTTGCCTGGATGGCGGTGCCTACGCCAAGGCCATCGTCCGAGCTGGCACCTATACCTTC
TCCTCTCTGGCCCGGAATCTGGAGCTTGGAAACTCAGTTCCAGGAACCGAGGATGCTGGCAAATCATCAATCAGG
ACGAATGCCGTCCGCTTCTTTCTGAGCTGTCTCAAACACGTCAGCTCGCAGGGCCGAAAGGAGCTCCTTTCGCAG
AGACACCTTATCTCTCGACTGACGTACTCCATCAAAACCGATCCGCCGCACGTCGCCTTGGAAATACTAGACGCA
CTTCAGTCACATGTGCTCATGGATCCCAAGATACCGCGCGATGTCAAGTTTCGCAACTTCAACATCAGGACACTG
CTGAGACTACTGGCCCTCTATGGGCTGCCAGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCAC
GAGTTTCTCATGTACGCTTGCACGTCGCCGGATGCTGGAATCCTATTCCCTTACAGGGGTCTTTACCCGAAGGAG
TCCGGCGACGAACAATCGGACGACAAAGCCGCCAGACAGGTCGGAAGCCAACCCGGAGGCAGTCAGGCCGCTCAT
GAGAATCAAGACCTTCCTGTACACAATTTCGCCCTGTCCGAGTTTGCCGCAAAGCTTCGCCCGTGGGCCAGCACG
AGACAGAGTCAACTTCTGGTGGCCATGTTTGAGGCCGCCCCAGAACTCATTGCCCACTACTTTCACGACAACCGA
TTTTTTACCTTTGAGCCCAAGGTGTCCATGACCTGGGTCGGATACGCCGCCTTCCTCTTCGACACCATCAGCATC
ACCCTCCGTCCTTCGTTTGGGGACCCTGTGCACTATGCTGACGGCCCTCCTCCCGCGGCCGTTCTGCTGGATAAC
ATCCTCCCCCCCGCCATCACTCAGAAAGTCCTCGTCCGATGTTTTTCGCCAAAGTCGGACGTGACGGCACTTTTT
GCCACAAAGATCCTCGTCGCCGCTCTGGAGAAGCTTGCCACGGCCCTCAAGATGCTGGATCCGGCGCAAGCTCGA
AAGGACGCCAAGTGGTCGGAAGCGGCCCGGCGGCTCGAGGATGCCTTTTGTCAGCGGGTGCCCGAAATGAAGGAA
ATCGTCCTATGTTACAAGGGGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTGCTGCTC
TACTACCGAGTGATCCCTCGAGTGGCTCTGGCCGCCAACTTTGATGTCTCGCCCTTGCTCACAGCTGTGCTGGAA
GGGCTGCGGCAAGAGGAGGATGAGCCTGGGACCCGACAACTCAGCCTCATTGAGTTGGAGGGCCTCGTGACTATA
GCCAGTTACTCGCCTGGTATGAGGTGGTTTTCCAGATTCGAAGGCCCGCGTCGTGAATCTTCAACCTCGGCGTTC
GTCGCCCTGCTTAAGCTTCTCTGTGGCGGTGACGACGATACTCCCTTTCGTCACCTCAAAGAAGCGTTGGCTGGC
GTTGCCGGGGAGAGCCAACTCGTCTCCAAGTCGACAGGCTTGAAACCACTGCTGGCGACCCTGCAACTCACCGTC
ACTCGGGCTGACACGGGGGACATGGAAACGGTATGGGCTTTCTTGGATAATTGCATAGGCCGCTGCGTCGCCTCT
CCGATCAAGTACATCGAAATCTTAGAGACCCTCTCGGTTGAGCAGACTGATGCTCCGCCGGCAGTGGAAGACGAC
GGATCGCTGTCATTGCTCAGCCTCGCACTGGTGGAGCAGCTGCCATTTGCCGTGAAATCCGGCGACAAGAAGAGC
ATCAAGCCTCTCGCGCGATTTCTCTCACTCTACTTCAACGCGTGTTATCGCTGGGAGGGTCGCGGCGAAGTCATC
AAGGCTCTTCATCAACAATCGCGCTGTACATTGTCAAAGACCAAAGTCAAGATGACCACTTTGGGAGAAAGCAGC
GATTTGACGGCCCTGAAAGCGACAGAGTCTGCTTCCGACACTGATCGTGATTCCTCCGGCGCCAAGGAGGGACAG
CCCAAAAAGCCGGGCGAGTTGGATCTGCATCAAGAGCTCCACGTTCCCCCCTTGGACGAGGGTGACGCGGCAGTC
CTCGCGAAATGCATCTCGAAGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGTACGACTCTTG
TTATCGGAGCATACGCACATCCGCAAAGAGGCTCTCACCGGCATCCTTAAAGTAGCAGCCCGCGTCAAGGACTCG
GCACTCGAGGAACGCTCGCAGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGTCACAGATTGAGTCA
GGCCCCGTCCCATCAGCTTTCGTGGCCTTCGCCATGCACGCCCTCGACGTGGTGCAGAGTCCATTGCATCCGCTG
TATCCGAAACTGAACCGCTACCTCACCCGCAGCCCCATGTGGCCGCCGGACAAGCTGCCGCTCGCCCACGACATC
CTCCACGGCGAGCCGTCAGAGGACGACAAGTACTACACCGAGATCGCCTGGCTCCTCGACTATCTCCTCGACAGC
CTGCGGACGCAGCGCGACATGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGTTGGCGCTCGGAAGCAAC
CCCTACCTCAGGACCGGGCTGCGCACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGTTGCATCCAAGGCGGCAGC
ACCACCCTCGTCACCAGGTTCGGCGTCCTCAGCTGGCTCCATGGACAACAAGCGGCAGCCGATGCGGCCGACGAG
GCTGCTGTTTGCGAGCGTCTGATGCGCCGCGTATGGGACACGTGTGACCACCATCGCGTTTCTGCCTGGAGCCAT
GGCGGCGCGCAGACGCTCGTCCGAGGAGTGGCCCGCGAAGGAGCGCGCTGA
Gene >Ophun1|1503
ATGGGCAAGAGACCCTCTTCCGGCGTCGACGGTCCGACCGCGCCTCGCAAGCGGCAACGGATAACCATCGACGCC
CCGGCCGGTGAAGACATCTCTTCCAGCGACCATTTGCGAAGCTTGCTAGCCTTTGACCAGGACCTTCGCAAGGCG
CGGCACGGTTGGCCATCTCTCTGACGACTTCGACGTTGGGTTCATACTAATCCGAGACTCAAGGTCTTCAATCCT
TGAAGAAGCTCCTCGACGACATCATCTCCGACCACGCCAACCGACGAGACAAGGTCGGCATCCTCCAACAATACC
TCGATGCCGGTAAACCAAGGGATGCCGGTGAAGATGCCATCTACCTCCGCGACATCATGGACATGTGGTCTCTCG
CTGTTCAGGTCAACGATGACGGCGTCATGTCCTCCGTTGCCGTCGTCTTGGCTCTACTTCTGAGCGTCGTCTCCC
AGTCCTTGCAGTTGGTGCCTCATGGCCTTGGAATTTGCCAGACACTCCTTCAGGAAAGGCAACTAAAGCTGTTAT
CCAAAAACTTGGCTTCTGATAACCGGAAAGCCTTTATCATCTCCCCTACGCTGCGTTTGCTGCGGGAAGCTGTTT
GCCTGGATGGCGGTGCCTACGCCAAGGCCATCGTCCGAGCTGGCACCTATACCTTCTCCTCTCTGGCCCGGAATC
TGGAGCTTGGAAACTCAGTTCCAGGAACCGAGGATGCTGGCAAATCATCAATCAGGACGAATGCCGTCCGCTTCT
TTCTGAGCTGTCTCAAACACGTCAGCTCGCAGGGCCGAAAGGAGCTCCTTTCGCAGAGACACCTTATCTCTCGAC
TGACGTACTCCATCAAAACCGATCCGCCGCACGTCGCCTTGGAAATACTAGACGCACTTCAGTCACATGTGCTCA
TGGATCCCAAGATACCGCGCGATGTCAAGTTTCGCAACTTCAACATCAGGACACTGCTGAGACTACTGGCCCTCT
ATGGGCTGCCAGGCGGCGACTCGGATGAGGGGAATCCTGTCAGTGACAGGGCTCACGAGTTTCTCATGTACGCTT
GCACGTCGCCGGATGCTGGAATCCTATTCCCTTACAGGGGTCTTTACCCGAAGGAGTCCGGCGACGAACAATCGG
ACGACAAAGCCGCCAGACAGGTCGGAAGCCAACCCGGAGGCAGTCAGGCCGCTCATGAGAATCAAGACCTTCCTG
TACACAATTTCGCCCTGTCCGAGTTTGCCGCAAAGCTTCGCCCGTGGGCCAGCACGAGACAGAGTCAACTTCTGG
TGGCCATGTTTGAGGCCGCCCCAGAACTCATTGCCCACTACTTTCACGACAACCGATTTTTTACCTTTGAGCCCA
AGGTGTCCATGACCTGGGTCGGATACGCCGCCTTCCTCTTCGACACCATCAGCATCACCCTCCGTCCTTCGTTTG
GGGACCCTGTGCACTATGCTGACGGCCCTCCTCCCGCGGCCGTTCTGCTGGATAACATCCTCCCCCCCGCCATCA
CTCAGAAAGTCCTCGTCCGATGTTTTTCGCCAAAGTCGGACGTGACGGCACTTTTTGCCACAAAGATCCTCGTCG
CCGCTCTGGAGAAGCTTGCCACGGCCCTCAAGATGCTGGATCCGGCGCAAGCTCGAAAGGACGCCAAGTGGTCGG
AAGCGGCCCGGCGGCTCGAGGATGCCTTTTGTCAGCGGGTGCCCGAAATGAAGGAAATCGTCCTATGTTACAAGG
GGATTTCCAAAGAAAACTCAATGCACAGGACTTTGGCGAGCCGTCTTTTGCTGCTCTACTACCGAGTGATCCCTC
GAGTGGCTCTGGCCGCCAACTTTGATGTCTCGCCCTTGCTCACAGCTGTGCTGGAAGGGCTGCGGCAAGAGGAGG
ATGAGCCTGGGACCCGACAACTCAGCCTCATTGAGTTGGAGGGCCTCGTGACTATAGCCAGTTACTCGCCTGGTA
TGAGGTGGTTTTCCAGATTCGAAGGCCCGCGTCGTGAATCTTCAACCTCGGCGTTCGTCGCCCTGCTTAAGCTTC
TCTGTGGCGGTGACGACGATACTCCCTTTCGTCACCTCAAAGAAGCGTTGGCTGGCGTTGCCGGGGAGAGCCAAC
TCGTCTCCAAGTCGACAGGCTTGAAACCACTGCTGGCGACCCTGCAACTCACCGTCACTCGGGCTGACACGGGGG
ACATGGAAACGGTATGGGCTTTCTTGGATAATTGCATAGGCCGCTGCGTCGCCTCTCCGATCAAGTACATCGAAA
TCTTAGAGACCCTCTCGGTTGAGCAGACTGATGCTCCGCCGGCAGTGGAAGACGACGGATCGCTGTCATTGCTCA
GCCTCGCACTGGTGGAGCAGCTGCCATTTGCCGTGAAATCCGGCGACAAGAAGAGCATCAAGCCTCTCGCGCGAT
TTCTCTCACTCTACTTCAACGCGTGTTATCGCTGGGAGGGTCGCGGCGAAGTCATCAAGGCTCTTCATCAACAAT
CGCGCTGTACATTGTCAAAGACCAAAGTCAAGATGACCACTTTGGGAGAAAGCAGCGATTTGACGGCCCTGAAAG
CGACAGAGTCTGCTTCCGACACTGATCGTGATTCCTCCGGCGCCAAGGAGGGACAGCCCAAAAAGCCGGGCGAGT
TGGATCTGCATCAAGAGCTCCACGTTCCCCCCTTGGACGAGGGTGACGCGGCAGTCCTCGCGAAATGCATCTCGA
AGACCTTGGAAGACGTGATAGAGGACGGATGGGTCGTCAAGTTGGTACGACTCTTGTTATCGGAGCATACGCACA
TCCGCAAAGAGGCTCTCACCGGCATCCTTAAAGTAGCAGCCCGCGTCAAGGACTCGGCACTCGAGGAACGCTCGC
AGATCTGGCTGCTTCTTTCAGAGCTTGCCGAGTCGTCAAGGTCACAGATTGAGTCAGGCCCCGTCCCATCAGCTT
TCGTGGCCTTCGCCATGCACGCCCTCGACGTGGTGCAGAGTCCATTGCATCCGCTGTATCCGAAACTGAACCGCT
ACCTCACCCGCAGCCCCATGTGGCCGCCGGACAAGCTGCCGCTCGCCCACGACATCCTCCACGGCGAGCCGTCAG
AGGACGACAAGTACTACACCGAGATCGCCTGGCTCCTCGACTATCTCCTCGACAGCCTGCGGACGCAGCGCGACA
TGGACGTCTTCCACGGCAAGAAATGGCTCGAGAAGCTGTTGGCGCTCGGAAGCAACCCCTACCTCAGGACCGGGC
TGCGCACCAGGCTCCTCAAGCTTGTCTACCGAGCAAGTTGCATCCAAGGCGGCAGCACCACCCTCGTCACCAGGT
TCGGCGTCCTCAGCTGGCTCCATGGACAACAAGCGGCAGCCGATGCGGCCGACGAGGCTGCTGTTTGCGAGCGTC
TGATGCGCCGCGTATGGGACACGTGTGACCACCATCGCGTTTCTGCCTGGAGCCATGGCGGCGCGCAGACGCTCG
TCCGAGGAGTGGCCCGCGAAGGAGCGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail