Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1494
Gene name
LocationContig_160:26114..29048
Strand+
Gene length (bp)2934
Transcript length (bp)2637
Coding sequence length (bp)2637
Protein length (aa) 879

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03707 MHYT Bacterial signalling protein N terminal repeat 9.0E-09 71 126

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34311|YKOW_BACSU Signaling protein YkoW OS=Bacillus subtilis (strain 168) GN=ykoW PE=3 SV=2 24 185 2.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 59 81 22
3 101 121 20
4 128 150 22
5 165 187 22
6 200 222 22
7 242 264 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1494
MQLQMASTQELFLQYEGKIVPHDYEAGLVVVSVIICFVGTSSALELIRRQTSNKGVHNLLLLAGAAICMGGIAMW
SMHYIGNRSVRFLDGQKEFEFVYKTGLAVVALLIPIIVLFVAFVIITRHGRVCWVRITLAGFISGATLVGMHYLV
DASIDNYKTVYHVGNIVGAALIGVFTNIGALAFLFVFESAWTDRWWKRPICAFLLAVCISAENWCAAAGTQYRLR
GPHHHPALLSTKGSIIVVICLTVGGFVFTVLSGVYSYWIQKDYAKKAQKVALAAAVFDDRGRIMVSHEGLLPSEV
ITDTFIPTSNNDVFDTSNPVFHWMFWASRNWPRIAHVLPGMEAHVASLSSKTNRKLKLKLLGEDGEAVENYNMIL
CELYCLAASSLSSRMKEDIESTGMLWDEIFATGDVSGSFGRSSSSYSGGSSELPMYRSSTSSIIKPEETNEKHDD
RSNDGHGKGSLMFIVRHVSSRRDVERLEAAGFRFAEIHRVLGSIRTGMQIKTPDFAARLRIMSTFNEQDSDLRPG
VHVGLFALRARVDLGGFDVLVQRKAKNLLPTVHLQRESLGQWQKDILERISGMTTPEIIENLNVDQFDSARERHF
ARQLLEAITSLRSWTDQPIFDEAKLNTSIVQVPCSSIDQSATCSVLTFQLMLPIHLTISFRNYEAIPLQFFKVRQ
FFSPGFNGPGRTSTGGMAQNGLHFPNSNSSLGGDSGPTTFMEFVKPGRRFRKNVPYRPSNHTLAQSFKRLSFGTS
GRNARPGSATGDATGDTLPFAAAMAPPGQADLHHGHSILVSQEVVVNYQQSFDPEADEMDITEKDTWEAGGPSEP
SRQYRPGLTPPPEAESYSVTATGTDVNRAKDEASFVDELLQNCMEQYKPKRRQ*
Coding >Ophun1|1494
ATGCAGCTCCAGATGGCGTCTACGCAGGAACTGTTCCTCCAGTATGAGGGCAAGATCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTCGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGTCAG
ACGTCCAACAAGGGAGTCCATAACCTTCTTTTGCTTGCTGGCGCTGCCATCTGTATGGGCGGAATTGCTATGTGG
TCGATGCACTACATTGGCAACAGATCCGTTCGCTTTCTCGACGGACAGAAAGAGTTCGAGTTCGTCTATAAGACG
GGTCTCGCCGTTGTCGCACTCTTAATCCCCATCATCGTCCTGTTCGTGGCCTTCGTCATCATCACCCGCCACGGA
AGAGTCTGCTGGGTGCGCATCACCCTTGCAGGCTTCATCTCCGGAGCGACGCTCGTGGGAATGCACTACCTCGTC
GACGCGTCCATCGACAACTACAAGACCGTCTATCACGTCGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTT
ACGAATATCGGCGCGCTGGCCTTTCTCTTCGTCTTTGAGTCTGCTTGGACCGACAGGTGGTGGAAGAGGCCCATT
TGCGCCTTTCTCCTGGCCGTTTGCATCTCCGCTGAGAACTGGTGTGCCGCCGCCGGAACGCAGTACAGACTGCGC
GGCCCTCACCATCATCCAGCGTTGCTATCGACCAAGGGCTCCATCATCGTCGTCATCTGCTTGACGGTAGGCGGC
TTCGTCTTCACCGTTCTGAGTGGCGTCTACTCGTACTGGATCCAGAAGGACTACGCCAAGAAGGCGCAGAAGGTG
GCCCTGGCAGCAGCAGTCTTTGACGACCGCGGGAGGATCATGGTCAGCCACGAAGGTCTTCTTCCTAGTGAAGTC
ATTACCGACACCTTTATCCCAACTTCAAACAACGACGTCTTTGACACCTCCAACCCCGTCTTCCACTGGATGTTC
TGGGCGTCTCGCAACTGGCCCAGAATTGCCCACGTCCTGCCAGGCATGGAAGCCCACGTGGCTAGCCTGTCGAGC
AAGACGAACCGCAAGCTGAAGCTCAAGCTGCTGGGCGAAGATGGAGAGGCGGTCGAGAACTACAACATGATTCTC
TGCGAGCTGTACTGCCTCGCCGCTTCGTCGCTCTCGTCGCGGATGAAGGAAGATATTGAGTCGACGGGCATGCTC
TGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCGGCCGCTCTTCATCTTCATACAGCGGCGGCAGC
AGTGAGCTGCCCATGTACCGCTCCTCGACAAGCTCCATCATCAAGCCGGAAGAGACGAATGAGAAGCACGATGAC
CGAAGCAACGACGGCCACGGAAAGGGATCTCTCATGTTCATCGTCCGACACGTCAGCAGCCGGCGAGACGTCGAG
AGGCTCGAGGCAGCTGGCTTCCGCTTCGCTGAGATCCATCGTGTTCTCGGCTCGATCCGGACGGGGATGCAGATC
AAGACGCCCGATTTCGCTGCCCGGCTACGTATCATGTCTACTTTCAACGAGCAGGACAGCGATCTCCGGCCTGGC
GTCCACGTCGGACTCTTCGCTCTCCGTGCCAGAGTCGATCTTGGTGGCTTCGACGTGCTGGTTCAGCGCAAGGCC
AAGAATCTGCTTCCGACGGTGCACCTTCAGAGGGAGTCGTTGGGACAGTGGCAGAAGGACATTCTCGAGCGCATC
AGCGGAATGACGACGCCTGAAATCATTGAGAACCTCAACGTCGACCAATTCGATTCCGCACGGGAACGTCATTTC
GCTCGCCAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGAAGCCAAGCTC
AACACTAGCATTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCAGCCACATGCTCGGTCCTGACATTCCAGCTG
ATGCTCCCGATCCACCTGACCATCTCATTCCGGAACTACGAGGCCATCCCTCTGCAGTTCTTCAAGGTCCGCCAG
TTCTTTAGCCCGGGCTTCAACGGCCCTGGACGTACGTCTACCGGCGGAATGGCACAGAACGGTCTTCACTTCCCC
AACAGCAACTCGTCTCTTGGTGGCGATTCAGGCCCGACGACCTTTATGGAGTTTGTGAAGCCGGGCCGTCGGTTC
AGGAAGAACGTTCCGTACAGGCCGTCGAACCATACCTTGGCCCAGAGCTTCAAGAGGTTGTCCTTTGGGACTAGT
GGCCGCAACGCGAGGCCCGGTTCGGCGACGGGCGACGCTACTGGGGACACGCTGCCCTTTGCGGCCGCTATGGCG
CCTCCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTTGTCTCACAGGAGGTTGTGGTGAATTATCAACAG
TCGTTTGATCCCGAGGCCGATGAGATGGACATTACGGAAAAGGACACCTGGGAGGCTGGAGGTCCGTCAGAGCCA
TCCCGTCAGTACCGGCCGGGCCTGACGCCGCCCCCGGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGAT
GTCAACCGGGCCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAACTGCATGGAACAGTACAAGCCCAAA
AGGAGGCAATGA
Transcript >Ophun1|1494
ATGCAGCTCCAGATGGCGTCTACGCAGGAACTGTTCCTCCAGTATGAGGGCAAGATCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTCGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGTCAG
ACGTCCAACAAGGGAGTCCATAACCTTCTTTTGCTTGCTGGCGCTGCCATCTGTATGGGCGGAATTGCTATGTGG
TCGATGCACTACATTGGCAACAGATCCGTTCGCTTTCTCGACGGACAGAAAGAGTTCGAGTTCGTCTATAAGACG
GGTCTCGCCGTTGTCGCACTCTTAATCCCCATCATCGTCCTGTTCGTGGCCTTCGTCATCATCACCCGCCACGGA
AGAGTCTGCTGGGTGCGCATCACCCTTGCAGGCTTCATCTCCGGAGCGACGCTCGTGGGAATGCACTACCTCGTC
GACGCGTCCATCGACAACTACAAGACCGTCTATCACGTCGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTT
ACGAATATCGGCGCGCTGGCCTTTCTCTTCGTCTTTGAGTCTGCTTGGACCGACAGGTGGTGGAAGAGGCCCATT
TGCGCCTTTCTCCTGGCCGTTTGCATCTCCGCTGAGAACTGGTGTGCCGCCGCCGGAACGCAGTACAGACTGCGC
GGCCCTCACCATCATCCAGCGTTGCTATCGACCAAGGGCTCCATCATCGTCGTCATCTGCTTGACGGTAGGCGGC
TTCGTCTTCACCGTTCTGAGTGGCGTCTACTCGTACTGGATCCAGAAGGACTACGCCAAGAAGGCGCAGAAGGTG
GCCCTGGCAGCAGCAGTCTTTGACGACCGCGGGAGGATCATGGTCAGCCACGAAGGTCTTCTTCCTAGTGAAGTC
ATTACCGACACCTTTATCCCAACTTCAAACAACGACGTCTTTGACACCTCCAACCCCGTCTTCCACTGGATGTTC
TGGGCGTCTCGCAACTGGCCCAGAATTGCCCACGTCCTGCCAGGCATGGAAGCCCACGTGGCTAGCCTGTCGAGC
AAGACGAACCGCAAGCTGAAGCTCAAGCTGCTGGGCGAAGATGGAGAGGCGGTCGAGAACTACAACATGATTCTC
TGCGAGCTGTACTGCCTCGCCGCTTCGTCGCTCTCGTCGCGGATGAAGGAAGATATTGAGTCGACGGGCATGCTC
TGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCGGCCGCTCTTCATCTTCATACAGCGGCGGCAGC
AGTGAGCTGCCCATGTACCGCTCCTCGACAAGCTCCATCATCAAGCCGGAAGAGACGAATGAGAAGCACGATGAC
CGAAGCAACGACGGCCACGGAAAGGGATCTCTCATGTTCATCGTCCGACACGTCAGCAGCCGGCGAGACGTCGAG
AGGCTCGAGGCAGCTGGCTTCCGCTTCGCTGAGATCCATCGTGTTCTCGGCTCGATCCGGACGGGGATGCAGATC
AAGACGCCCGATTTCGCTGCCCGGCTACGTATCATGTCTACTTTCAACGAGCAGGACAGCGATCTCCGGCCTGGC
GTCCACGTCGGACTCTTCGCTCTCCGTGCCAGAGTCGATCTTGGTGGCTTCGACGTGCTGGTTCAGCGCAAGGCC
AAGAATCTGCTTCCGACGGTGCACCTTCAGAGGGAGTCGTTGGGACAGTGGCAGAAGGACATTCTCGAGCGCATC
AGCGGAATGACGACGCCTGAAATCATTGAGAACCTCAACGTCGACCAATTCGATTCCGCACGGGAACGTCATTTC
GCTCGCCAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGAAGCCAAGCTC
AACACTAGCATTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCAGCCACATGCTCGGTCCTGACATTCCAGCTG
ATGCTCCCGATCCACCTGACCATCTCATTCCGGAACTACGAGGCCATCCCTCTGCAGTTCTTCAAGGTCCGCCAG
TTCTTTAGCCCGGGCTTCAACGGCCCTGGACGTACGTCTACCGGCGGAATGGCACAGAACGGTCTTCACTTCCCC
AACAGCAACTCGTCTCTTGGTGGCGATTCAGGCCCGACGACCTTTATGGAGTTTGTGAAGCCGGGCCGTCGGTTC
AGGAAGAACGTTCCGTACAGGCCGTCGAACCATACCTTGGCCCAGAGCTTCAAGAGGTTGTCCTTTGGGACTAGT
GGCCGCAACGCGAGGCCCGGTTCGGCGACGGGCGACGCTACTGGGGACACGCTGCCCTTTGCGGCCGCTATGGCG
CCTCCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTTGTCTCACAGGAGGTTGTGGTGAATTATCAACAG
TCGTTTGATCCCGAGGCCGATGAGATGGACATTACGGAAAAGGACACCTGGGAGGCTGGAGGTCCGTCAGAGCCA
TCCCGTCAGTACCGGCCGGGCCTGACGCCGCCCCCGGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGAT
GTCAACCGGGCCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAACTGCATGGAACAGTACAAGCCCAAA
AGGAGGCAATGA
Gene >Ophun1|1494
ATGCAGCTCCAGATGGCGTCTACGCAGGAACTGTTCCTCCAGTATGAGGGCAAGATCGTGCCTCACGACTACGAG
GCTGGTCTTGTTGTCGTCAGCGTCATCATTTGCTTCGTCGGCACCAGCTCTGCTCTTGAGCTCATCCGCCGTCAG
ACGTCCAACAAGGGAGTCCATAACCTGTAAGATCCGGGTCTGTTAGAGTCGTGTGAGACTTGACTGACGTGCTGC
TCTCTCAGTCTTTTGCTTGCTGGCGCTGCCATCTGTATGGGCGGAATTGCTATGTGGTCGATGGTAGGTGATGGC
ATCCAAGCCTCTTCGTTTCCACGATGGCTAACAAGACTTCCAGCACTACATTGGCAACAGATCCGTTCGCTTTCT
CGACGGACAGAAAGAGTTCGAGTTCGTCTATAAGACGGGTCTCGCCGTTGTCGCACTCTTAATCCCCATCATCGT
CCTGTTCGTGGCCTTCGTCATCATCACCCGCCACGGAAGAGTCTGCTGGGTGCGCATCACCCTTGCAGGCTTCAT
CTCCGGAGCGACGCTCGTGGGAATGCACTACCTCGTCGACGCGTCCATCGACAACTACAAGACCGTCTATCACGT
CGGCAACATCGTCGGCGCCGCCTTGATAGGAGTCTTTACGAATATCGGCGCGCTGGCCTTTCTCTTCGTCTTTGA
GTCTGCTTGGACCGACAGGTGGTGGAAGAGGCCCATTTGCGCCTTTCTCCTGGCCGTTTGCATCTCCGCTGAGAA
CTGGTGTGCCGCCGCCGGAACGCAGTACAGACTGCGCGGCCCTCACCATCATCCAGCGTTGCTATCGACCAAGGG
CTCCATCATCGTCGTCATCTGCTTGGTAAGTCTGCTTCGCTCCCTTACTCTACGGTGAAGAGTCTAACAGAGAGT
AAAGACGGTAGGCGGCTTCGTCTTCACCGTTCTGAGTGGCGTCTACTCGTACTGGATCCAGAAGGACTACGCCAA
GAAGGCGCAGAAGGTGGCCCTGGCAGCAGCAGTCTTTGACGACCGCGGGAGGATCATGGTCAGCCACGAAGGTCT
TCTTCCTAGTGAAGTCATTACCGACACCTTTATCCCAACTGTGAGTGTTTCGCTTCGCTCTTCCTTCTGTGTGAG
TTGGAAGTTGCAGAATCTGACATGGCGAAATCAGTCAAACAACGACGTCTTTGACACCTCCAACCCCGTCTTCCA
CTGGATGTTCTGGGCGTCTCGCAACTGGCCCAGAATTGCCCACGTCCTGCCAGGCATGGAAGCCCACGTGGCTAG
CCTGTCGAGCAAGACGAACCGCAAGCTGAAGCTCAAGCTGCTGGGCGAAGATGGAGAGGCGGTCGAGAACTACAA
CATGATTCTCTGCGAGCTGTACTGCCTCGCCGCTTCGTCGCTCTCGTCGCGGATGAAGGAAGATATTGAGTCGAC
GGGCATGCTCTGGGACGAGATCTTTGCTACGGGTGATGTCTCGGGCTCTTTCGGCCGCTCTTCATCTTCATACAG
CGGCGGCAGCAGTGAGCTGCCCATGTACCGCTCCTCGACAAGCTCCATCATCAAGCCGGAAGAGACGAATGAGAA
GCACGATGACCGAAGCAACGACGGCCACGGAAAGGGATCTCTCATGTTCATCGTCCGACACGTCAGCAGCCGGCG
AGACGTCGAGAGGCTCGAGGCAGCTGGCTTCCGCTTCGCTGAGATCCATCGTGTTCTCGGCTCGATCCGGACGGG
GATGCAGATCAAGACGCCCGATTTCGCTGCCCGGCTACGTATCATGTCTACTTTCAACGAGCAGGACAGCGATCT
CCGGCCTGGCGTCCACGTCGGACTCTTCGCTCTCCGTGCCAGAGTCGATCTTGGTGGCTTCGACGTGCTGGTTCA
GCGCAAGGCCAAGAATCTGCTTCCGACGGTGCACCTTCAGAGGGAGTCGTTGGGACAGTGGCAGAAGGACATTCT
CGAGCGCATCAGCGGAATGACGACGCCTGAAATCATTGAGAACCTCAACGTCGACCAATTCGATTCCGCACGGGA
ACGTCATTTCGCTCGCCAGCTGCTCGAGGCCATCACCTCGCTACGATCGTGGACAGACCAGCCCATCTTCGACGA
AGCCAAGCTCAACACTAGCATTGTCCAGGTTCCCTGCTCGTCCATCGACCAGTCAGCCACATGCTCGGTCCTGAC
ATTCCAGCTGATGCTCCCGATCCACCTGACCATCTCATTCCGGAACTACGAGGCCATCCCTCTGCAGTTCTTCAA
GGTCCGCCAGTTCTTTAGCCCGGGCTTCAACGGCCCTGGACGTACGTCTACCGGCGGAATGGCACAGAACGGTCT
TCACTTCCCCAACAGCAACTCGTCTCTTGGTGGCGATTCAGGCCCGACGACCTTTATGGAGTTTGTGAAGCCGGG
CCGTCGGTTCAGGAAGAACGTTCCGTACAGGCCGTCGAACCATACCTTGGCCCAGAGCTTCAAGAGGTTGTCCTT
TGGGACTAGTGGCCGCAACGCGAGGCCCGGTTCGGCGACGGGCGACGCTACTGGGGACACGCTGCCCTTTGCGGC
CGCTATGGCGCCTCCGGGGCAGGCAGATCTGCATCATGGCCACAGCATCCTTGTCTCACAGGAGGTTGTGGTGAA
TTATCAACAGGTTAGTTGTCTCGACGCTTCTCTGTCTAGTTCTGATACAGATGCTAACATTCGTCTTCACAGTCG
TTTGATCCCGAGGCCGATGAGATGGACATTACGGAAAAGGACACCTGGGAGGCTGGAGGTCCGTCAGAGCCATCC
CGTCAGTACCGGCCGGGCCTGACGCCGCCCCCGGAGGCCGAGTCGTACAGCGTCACGGCGACGGGGACGGATGTC
AACCGGGCCAAGGACGAGGCCAGCTTCGTCGACGAGTTGCTGCAGAACTGCATGGAACAGTACAAGCCCAAAAGG
AGGCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail