Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1487
Gene name
LocationContig_160:9988..11854
Strand+
Gene length (bp)1866
Transcript length (bp)1866
Coding sequence length (bp)1866
Protein length (aa) 622

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04083 Abhydro_lipase Partial alpha/beta-hydrolase lipase region 8.4E-20 231 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 227 599 1.0E-75
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 227 619 3.0E-71
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 223 599 6.0E-30
sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 230 599 1.0E-26
sp|P80035|LIPG_CANLF Gastric triacylglycerol lipase OS=Canis lupus familiaris GN=LIPF PE=1 SV=2 227 599 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 227 599 1.0E-75
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 227 619 3.0E-71
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 223 599 6.0E-30
sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 230 599 1.0E-26
sp|P80035|LIPG_CANLF Gastric triacylglycerol lipase OS=Canis lupus familiaris GN=LIPF PE=1 SV=2 227 599 1.0E-26
sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1 230 599 1.0E-25
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 239 599 2.0E-25
sp|P38571|LICH_HUMAN Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2 230 599 3.0E-25
sp|P04634|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=1 SV=1 239 599 3.0E-25
sp|Q8K2A6|LIPM_MOUSE Lipase member M OS=Mus musculus GN=Lipm PE=2 SV=1 219 611 4.0E-25
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 230 607 7.0E-25
sp|Q4R4S5|LICH_MACFA Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis GN=LIPA PE=2 SV=1 230 599 7.0E-25
sp|Q9Z0M5|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=1 SV=2 220 601 7.0E-24
sp|Q5VXJ0|LIPK_HUMAN Lipase member K OS=Homo sapiens GN=LIPK PE=2 SV=2 239 595 5.0E-22
sp|Q5VXI9|LIPN_HUMAN Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2 239 599 2.0E-21
sp|Q64194|LICH_RAT Lysosomal acid lipase/cholesteryl ester hydrolase OS=Rattus norvegicus GN=Lipa PE=2 SV=1 247 599 2.0E-20
sp|Q5W064|LIPJ_HUMAN Lipase member J OS=Homo sapiens GN=LIPJ PE=2 SV=3 239 599 2.0E-20
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 239 599 3.0E-20
sp|Q8BM14|LIPK_MOUSE Lipase member K OS=Mus musculus GN=Lipk PE=2 SV=1 231 599 5.0E-20
sp|Q5VYY2|LIPM_HUMAN Lipase member M OS=Homo sapiens GN=LIPM PE=2 SV=2 219 445 6.0E-20
sp|Q3U4B4|LIPN_MOUSE Lipase member N OS=Mus musculus GN=Lipn PE=2 SV=1 239 599 1.0E-19
sp|O46107|LIP1_DROME Lipase 1 OS=Drosophila melanogaster GN=Lip1 PE=2 SV=2 237 602 8.0E-19
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 240 595 5.0E-18
sp|J3SDX8|LICH_CROAD Putative lysosomal acid lipase/cholesteryl ester hydrolase OS=Crotalus adamanteus PE=2 SV=1 223 602 4.0E-17
sp|O46108|LIP3_DROME Lipase 3 OS=Drosophila melanogaster GN=Lip3 PE=2 SV=1 239 595 1.0E-16
sp|Q3YBN2|TALLP_MESAU Tear acid lipase-like protein OS=Mesocricetus auratus PE=1 SV=1 231 413 9.0E-16
sp|Q67ZU1|LIP2_ARATH Triacylglycerol lipase 2 OS=Arabidopsis thaliana GN=LIP2 PE=2 SV=1 239 424 6.0E-13
sp|Q71DJ5|LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1 247 424 3.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

Domain # Start End Length
1 139 161 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1487
MEASQDNTRHPLALTAARFSRKLSTSGSSSAAIHAHLVTPQDPVLSASVNGNVMGESGAVECHRDNISYNKTASP
DAVETPDHVIQVSPRPNDKIAQRSVEVAVRESTTPSYTHSLFPPLPVYGPPSLLRTSQSLLYRLSSSVLSLCFLG
AIVAGSLLSSVPSICRRLLLLNLDHQRAFYEEEKRRSEMRRKARKKWERKASKNHLVPDDEETADEYPPTEGGRD
PIVCDVSYYARRVGLDAETFLVETEDGFILELWHVFDPKECDEKKTALRQSDGQSETAERGRRFPVLLMHGLLQS
SGAYCSNDDESLAFWLCKSGFDVWLGNNRCGFRPRHQTLDYSDPRMWCWNIRQMGVLDLPALTARIVAETGFAKM
GLVCHSQGTAQTLVALAKEQRPELGNRLTVFCALAPAAYAGPLVGKTYFRFMRVISTSMFRAVFGVHAFIPLMMQ
MHRLLPPRLYGWMGYRVFSYLFDWTDARWDRELRDRMFQFAPVYVSAESMRWWLGREGFAKHRCILATKETGDVM
SDAWYDERVPPFALWVCGNDDLVDGRRLLQRFEEGREPHVRVVHSKVVDGYEHLDVIWAMDAVDQVFKEVREVLW
KTCDVRHSCRVPAGCEAVEEV*
Coding >Ophun1|1487
ATGGAGGCGTCTCAAGACAACACCCGCCATCCGCTGGCGCTAACGGCCGCCAGGTTCTCTCGAAAGCTCTCAACG
TCTGGCTCTTCTTCTGCAGCCATCCATGCCCATCTAGTCACGCCGCAAGACCCCGTGCTGAGCGCATCGGTCAAC
GGAAACGTCATGGGAGAATCGGGAGCTGTCGAGTGCCATCGGGATAACATCAGCTACAACAAGACGGCGAGTCCA
GATGCCGTCGAAACGCCAGACCACGTCATCCAGGTGTCACCGAGGCCGAATGACAAAATTGCACAGAGATCGGTC
GAGGTCGCGGTGCGAGAGTCGACTACCCCGTCTTACACGCACTCTCTATTTCCTCCTCTTCCGGTTTACGGCCCG
CCATCTCTCCTACGCACTTCTCAGAGCCTACTCTACCGACTGTCGTCATCTGTCCTCAGCCTTTGTTTTCTTGGC
GCCATCGTGGCCGGCTCCTTGTTGAGCAGCGTGCCAAGTATCTGTCGCAGGCTGTTGCTACTAAACCTTGATCAT
CAGCGTGCGTTTTACGAGGAGGAAAAAAGGCGGTCGGAGATGAGAAGAAAGGCGCGCAAGAAGTGGGAAAGAAAA
GCCTCCAAGAACCATTTAGTCCCGGACGACGAGGAGACGGCAGACGAGTATCCCCCGACAGAAGGGGGAAGGGAC
CCGATCGTATGCGACGTCAGTTACTACGCGAGAAGGGTCGGGCTAGACGCCGAGACGTTTCTGGTGGAGACTGAA
GATGGCTTCATACTCGAGCTCTGGCACGTCTTCGACCCCAAAGAATGCGATGAAAAGAAGACAGCTCTTCGACAG
TCCGATGGGCAGAGTGAGACGGCAGAAAGGGGCCGACGATTCCCCGTTCTCTTAATGCATGGGCTGCTGCAGAGC
TCCGGCGCGTACTGCAGCAACGATGACGAGTCGCTAGCCTTTTGGCTGTGTAAGTCGGGCTTTGACGTGTGGCTG
GGCAACAATCGGTGCGGATTCCGGCCCCGACATCAGACACTCGACTACAGCGACCCGCGCATGTGGTGCTGGAAC
ATCCGACAGATGGGCGTGCTGGACCTGCCGGCGCTGACGGCAAGGATAGTGGCTGAAACGGGCTTCGCTAAGATG
GGCCTCGTCTGCCACTCTCAGGGGACGGCGCAGACGCTGGTGGCGCTGGCCAAAGAACAACGGCCGGAGCTCGGA
AACCGGTTGACGGTGTTTTGCGCCCTGGCACCTGCGGCGTACGCGGGACCGCTGGTCGGTAAGACGTACTTTCGA
TTCATGCGGGTAATATCGACGAGCATGTTCCGGGCCGTGTTCGGAGTGCACGCCTTTATCCCGTTGATGATGCAG
ATGCATCGACTGCTGCCGCCGCGGCTGTACGGGTGGATGGGCTACAGGGTGTTTTCCTACCTGTTTGACTGGACG
GACGCGCGATGGGATCGTGAGCTACGAGACCGCATGTTTCAGTTTGCGCCCGTCTACGTCAGTGCCGAGTCGATG
CGCTGGTGGCTCGGGCGCGAGGGCTTCGCTAAGCACCGGTGCATACTGGCAACGAAGGAGACGGGAGACGTGATG
AGCGACGCCTGGTACGACGAGCGAGTTCCTCCGTTTGCGCTGTGGGTTTGCGGCAACGACGATCTGGTTGACGGG
CGACGACTGCTTCAGAGGTTCGAGGAGGGTCGAGAGCCGCACGTGCGAGTGGTTCACAGCAAGGTTGTGGACGGG
TACGAGCACCTGGACGTCATCTGGGCCATGGACGCTGTCGACCAGGTCTTCAAAGAGGTGCGGGAGGTGCTGTGG
AAGACGTGTGACGTGAGACATTCGTGCCGCGTGCCGGCGGGCTGCGAGGCCGTCGAGGAGGTATGA
Transcript >Ophun1|1487
ATGGAGGCGTCTCAAGACAACACCCGCCATCCGCTGGCGCTAACGGCCGCCAGGTTCTCTCGAAAGCTCTCAACG
TCTGGCTCTTCTTCTGCAGCCATCCATGCCCATCTAGTCACGCCGCAAGACCCCGTGCTGAGCGCATCGGTCAAC
GGAAACGTCATGGGAGAATCGGGAGCTGTCGAGTGCCATCGGGATAACATCAGCTACAACAAGACGGCGAGTCCA
GATGCCGTCGAAACGCCAGACCACGTCATCCAGGTGTCACCGAGGCCGAATGACAAAATTGCACAGAGATCGGTC
GAGGTCGCGGTGCGAGAGTCGACTACCCCGTCTTACACGCACTCTCTATTTCCTCCTCTTCCGGTTTACGGCCCG
CCATCTCTCCTACGCACTTCTCAGAGCCTACTCTACCGACTGTCGTCATCTGTCCTCAGCCTTTGTTTTCTTGGC
GCCATCGTGGCCGGCTCCTTGTTGAGCAGCGTGCCAAGTATCTGTCGCAGGCTGTTGCTACTAAACCTTGATCAT
CAGCGTGCGTTTTACGAGGAGGAAAAAAGGCGGTCGGAGATGAGAAGAAAGGCGCGCAAGAAGTGGGAAAGAAAA
GCCTCCAAGAACCATTTAGTCCCGGACGACGAGGAGACGGCAGACGAGTATCCCCCGACAGAAGGGGGAAGGGAC
CCGATCGTATGCGACGTCAGTTACTACGCGAGAAGGGTCGGGCTAGACGCCGAGACGTTTCTGGTGGAGACTGAA
GATGGCTTCATACTCGAGCTCTGGCACGTCTTCGACCCCAAAGAATGCGATGAAAAGAAGACAGCTCTTCGACAG
TCCGATGGGCAGAGTGAGACGGCAGAAAGGGGCCGACGATTCCCCGTTCTCTTAATGCATGGGCTGCTGCAGAGC
TCCGGCGCGTACTGCAGCAACGATGACGAGTCGCTAGCCTTTTGGCTGTGTAAGTCGGGCTTTGACGTGTGGCTG
GGCAACAATCGGTGCGGATTCCGGCCCCGACATCAGACACTCGACTACAGCGACCCGCGCATGTGGTGCTGGAAC
ATCCGACAGATGGGCGTGCTGGACCTGCCGGCGCTGACGGCAAGGATAGTGGCTGAAACGGGCTTCGCTAAGATG
GGCCTCGTCTGCCACTCTCAGGGGACGGCGCAGACGCTGGTGGCGCTGGCCAAAGAACAACGGCCGGAGCTCGGA
AACCGGTTGACGGTGTTTTGCGCCCTGGCACCTGCGGCGTACGCGGGACCGCTGGTCGGTAAGACGTACTTTCGA
TTCATGCGGGTAATATCGACGAGCATGTTCCGGGCCGTGTTCGGAGTGCACGCCTTTATCCCGTTGATGATGCAG
ATGCATCGACTGCTGCCGCCGCGGCTGTACGGGTGGATGGGCTACAGGGTGTTTTCCTACCTGTTTGACTGGACG
GACGCGCGATGGGATCGTGAGCTACGAGACCGCATGTTTCAGTTTGCGCCCGTCTACGTCAGTGCCGAGTCGATG
CGCTGGTGGCTCGGGCGCGAGGGCTTCGCTAAGCACCGGTGCATACTGGCAACGAAGGAGACGGGAGACGTGATG
AGCGACGCCTGGTACGACGAGCGAGTTCCTCCGTTTGCGCTGTGGGTTTGCGGCAACGACGATCTGGTTGACGGG
CGACGACTGCTTCAGAGGTTCGAGGAGGGTCGAGAGCCGCACGTGCGAGTGGTTCACAGCAAGGTTGTGGACGGG
TACGAGCACCTGGACGTCATCTGGGCCATGGACGCTGTCGACCAGGTCTTCAAAGAGGTGCGGGAGGTGCTGTGG
AAGACGTGTGACGTGAGACATTCGTGCCGCGTGCCGGCGGGCTGCGAGGCCGTCGAGGAGGTATGA
Gene >Ophun1|1487
ATGGAGGCGTCTCAAGACAACACCCGCCATCCGCTGGCGCTAACGGCCGCCAGGTTCTCTCGAAAGCTCTCAACG
TCTGGCTCTTCTTCTGCAGCCATCCATGCCCATCTAGTCACGCCGCAAGACCCCGTGCTGAGCGCATCGGTCAAC
GGAAACGTCATGGGAGAATCGGGAGCTGTCGAGTGCCATCGGGATAACATCAGCTACAACAAGACGGCGAGTCCA
GATGCCGTCGAAACGCCAGACCACGTCATCCAGGTGTCACCGAGGCCGAATGACAAAATTGCACAGAGATCGGTC
GAGGTCGCGGTGCGAGAGTCGACTACCCCGTCTTACACGCACTCTCTATTTCCTCCTCTTCCGGTTTACGGCCCG
CCATCTCTCCTACGCACTTCTCAGAGCCTACTCTACCGACTGTCGTCATCTGTCCTCAGCCTTTGTTTTCTTGGC
GCCATCGTGGCCGGCTCCTTGTTGAGCAGCGTGCCAAGTATCTGTCGCAGGCTGTTGCTACTAAACCTTGATCAT
CAGCGTGCGTTTTACGAGGAGGAAAAAAGGCGGTCGGAGATGAGAAGAAAGGCGCGCAAGAAGTGGGAAAGAAAA
GCCTCCAAGAACCATTTAGTCCCGGACGACGAGGAGACGGCAGACGAGTATCCCCCGACAGAAGGGGGAAGGGAC
CCGATCGTATGCGACGTCAGTTACTACGCGAGAAGGGTCGGGCTAGACGCCGAGACGTTTCTGGTGGAGACTGAA
GATGGCTTCATACTCGAGCTCTGGCACGTCTTCGACCCCAAAGAATGCGATGAAAAGAAGACAGCTCTTCGACAG
TCCGATGGGCAGAGTGAGACGGCAGAAAGGGGCCGACGATTCCCCGTTCTCTTAATGCATGGGCTGCTGCAGAGC
TCCGGCGCGTACTGCAGCAACGATGACGAGTCGCTAGCCTTTTGGCTGTGTAAGTCGGGCTTTGACGTGTGGCTG
GGCAACAATCGGTGCGGATTCCGGCCCCGACATCAGACACTCGACTACAGCGACCCGCGCATGTGGTGCTGGAAC
ATCCGACAGATGGGCGTGCTGGACCTGCCGGCGCTGACGGCAAGGATAGTGGCTGAAACGGGCTTCGCTAAGATG
GGCCTCGTCTGCCACTCTCAGGGGACGGCGCAGACGCTGGTGGCGCTGGCCAAAGAACAACGGCCGGAGCTCGGA
AACCGGTTGACGGTGTTTTGCGCCCTGGCACCTGCGGCGTACGCGGGACCGCTGGTCGGTAAGACGTACTTTCGA
TTCATGCGGGTAATATCGACGAGCATGTTCCGGGCCGTGTTCGGAGTGCACGCCTTTATCCCGTTGATGATGCAG
ATGCATCGACTGCTGCCGCCGCGGCTGTACGGGTGGATGGGCTACAGGGTGTTTTCCTACCTGTTTGACTGGACG
GACGCGCGATGGGATCGTGAGCTACGAGACCGCATGTTTCAGTTTGCGCCCGTCTACGTCAGTGCCGAGTCGATG
CGCTGGTGGCTCGGGCGCGAGGGCTTCGCTAAGCACCGGTGCATACTGGCAACGAAGGAGACGGGAGACGTGATG
AGCGACGCCTGGTACGACGAGCGAGTTCCTCCGTTTGCGCTGTGGGTTTGCGGCAACGACGATCTGGTTGACGGG
CGACGACTGCTTCAGAGGTTCGAGGAGGGTCGAGAGCCGCACGTGCGAGTGGTTCACAGCAAGGTTGTGGACGGG
TACGAGCACCTGGACGTCATCTGGGCCATGGACGCTGTCGACCAGGTCTTCAAAGAGGTGCGGGAGGTGCTGTGG
AAGACGTGTGACGTGAGACATTCGTGCCGCGTGCCGGCGGGCTGCGAGGCCGTCGAGGAGGTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail