Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1479
Gene name
LocationContig_16:55482..61435
Strand-
Gene length (bp)5953
Transcript length (bp)5175
Coding sequence length (bp)5175
Protein length (aa) 1725

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07350 DUF1479 Protein of unknown function (DUF1479) 1.0E-144 1302 1698
PF01822 WSC WSC domain 1.1E-15 914 992
PF01822 WSC WSC domain 6.6E-17 1037 1115
PF01822 WSC WSC domain 4.3E-16 1184 1258

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 1306 1699 6.0E-50
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 999 1263 5.0E-26
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1034 1263 2.0E-25
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1029 1263 1.0E-24
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 903 1122 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P75791|YBIU_ECOLI Uncharacterized protein YbiU OS=Escherichia coli (strain K12) GN=ybiU PE=1 SV=1 1306 1699 6.0E-50
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 999 1263 5.0E-26
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 1034 1263 2.0E-25
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 1029 1263 1.0E-24
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 903 1122 5.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 912 1259 6.0E-21
sp|D4AUF1|WSCD1_ARTBC WSC domain-containing protein ARB_07867 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07867 PE=1 SV=1 905 1123 3.0E-16
sp|P84675|PFM_CHAGB Putative fungistatic metabolite OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CHGG_05463 PE=1 SV=2 904 1123 7.0E-15
sp|D4AUF4|WSCD2_ARTBC WSC domain-containing protein ARB_07870 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07870 PE=1 SV=1 1178 1266 5.0E-14
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 878 1097 3.0E-13
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 913 1123 6.0E-12
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 878 1086 1.0E-11
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 910 1123 1.0E-11
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 900 1086 9.0E-11
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1037 1124 1.0E-10
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 913 1123 2.0E-10
sp|Q0IIY2|WSCD1_XENTR WSC domain-containing protein 1 OS=Xenopus tropicalis GN=wscd1 PE=2 SV=1 1012 1218 3.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 900 1086 5.0E-10
sp|Q80XH4|WSCD1_MOUSE WSC domain-containing protein 1 OS=Mus musculus GN=Wscd1 PE=2 SV=1 1013 1233 6.0E-10
sp|D4PHA7|WSCD2_MOUSE WSC domain-containing protein 2 OS=Mus musculus GN=Wscd2 PE=2 SV=1 1037 1124 2.0E-09
sp|Q658N2|WSCD1_HUMAN WSC domain-containing protein 1 OS=Homo sapiens GN=WSCD1 PE=2 SV=1 1020 1124 3.0E-09
sp|Q505J3|WSCD1_RAT WSC domain-containing protein 1 OS=Rattus norvegicus GN=Wscd1 PE=2 SV=1 1013 1125 5.0E-09
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 1035 1153 7.0E-09
sp|Q5QQ53|XYLT_DROPS Xylosyltransferase oxt OS=Drosophila pseudoobscura pseudoobscura GN=oxt PE=2 SV=1 1035 1153 8.0E-09
sp|Q2TBF2|WSCD2_HUMAN WSC domain-containing protein 2 OS=Homo sapiens GN=WSCD2 PE=2 SV=2 1037 1124 9.0E-09
sp|Q8K1S7|KREM2_MOUSE Kremen protein 2 OS=Mus musculus GN=Kremen2 PE=1 SV=1 1037 1124 5.0E-07
sp|Q8NCW0|KREM2_HUMAN Kremen protein 2 OS=Homo sapiens GN=KREMEN2 PE=2 SV=1 1037 1124 1.0E-06
sp|Q7KVA1|XYLT_DROME Xylosyltransferase oxt OS=Drosophila melanogaster GN=oxt PE=2 SV=1 916 992 7.0E-06
sp|A2BGL3|WSCD2_DANRE WSC domain-containing protein 2 OS=Danio rerio GN=wscd2 PE=3 SV=1 1160 1258 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999788

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup368
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3480
Ophiocordyceps australis map64 (Brazil) OphauB2|6705
Ophiocordyceps camponoti-floridani Ophcf2|02181
Ophiocordyceps camponoti-rufipedis Ophun1|1479 (this protein)
Ophiocordyceps kimflemingae Ophio5|2863
Ophiocordyceps kimflemingae Ophio5|2864
Ophiocordyceps subramaniannii Hirsu2|10134
Ophiocordyceps subramaniannii Hirsu2|559

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1479
MKPLLLSAFVGLVRALASTDTITWGGDGSRAGYQPNHNMDPAVVASPQFGQLFGTLLPGSFASQPEQIFSQPLVY
TPAGGHQFVYVATTLNNVYKLDARTGAILASRNLHLPFLAADLDGCNDINPAVGIISTGTIDPATDTLYLTAKTY
VDQTLVGRAQGRPAGRYYVHALDVNDLTERPNFPVNLEGLLARNNPSRMFTGGIHLQRPALLLAGQYLYAGFASH
CVQYNFTGWIIGLDKSSGAVVERWATEGVGVPDTVRGGGIWMSGGGLSYDGAGSIFLATGNGYASQLSTIPVRGY
NPPTSLEEAALHLTVNSDGSLSLVDFFMPWEKQAMDGADKDLGTSPLEILPAQFACGDVKRIGVVTAKTGKTYWL
NLDNLGGYRNGKDGLDDIIQSYQNENSVYSGAGVYPLEGGYVYINVIQYPTSVFKFSCNGGVPAFTKVAVSPTPN
AYVLGVGHASVTSMADEPGTALLWVTDVQGPGVRVYDAVPRDGSLVSVNSFNVPGVTKFSRAVFGDGIMYVGTTS
GFVYGFGSPVNSPLNCTSPLDFGTVDIRATSDAKAVVCRAVVDLTVTGLGLADGKNFVLSELPLLPLKLSQGQSF
VVNARFGPSTVGLLSVDIVANTTNGAPGFSTNTHARLVGTGRSAGPLLAVSPNTLSFPGLVSGQDPNGVSETVVV
SNRGNAALNIRSILYSADNSTAPQTYDGQGDLLVGRFTLQKLPNMVAANAGSAINVLFNSSISGTFSATIRFITD
GGNASVTIYASSGPAPVALLEFQTIDGLGWVRYEPGTPFSFGNVTENTSRSLKFRITNAAPTGGVKLSLTVSKPP
FGVSGLVKAVNQIDLAEGSSFAPGQSATAVLTCTAPKSQWNVDAYNGTSQWTLNTNDPTLGKQFVRFFCNAVAEQ
APPLLPGGRGQYRYAGCFKDNTPERQLPNQVVADDGLTNAMCIAACAKSNYVFCGTEYLRECWAGDRIPMQKVDD
ENCNYNCAGSINQICGGNGVNDGAGGAYISLFADSLRWDGNLTRPPPPGPADNPGVAGFTSIGCYTEGNPGRALP
NGVNTDKRTVAACVNACKAATFSMAGVEYGGECWCGNALGTGSVPAPAADCAMTCNDNSTEYCGGPSRLNVYRLG
SPASSTSTGPSTPSSSASPPRTSSSTTVVTTPTTTSSSSSSAPTPTGLVVKNTVGRYSFQGCWTEATNGRALGGN
AYADDKMTLESCASFCNGFRYFATEYGRECYCGDSLGGGSVKAVNQNDCSFPCAGDRAAKVKGHRVWSSGHKKEG
DISDSFVSLSGTERGALPDRFRQLKCELLRAENELIAQKGSGVIPQVDVEDLDGGCEESVRDEIKKRGVVVVKGV
VPEDEARRYKFELDEYIAKNPQTRAFPAHDPQVYELYWSGPQLKARAHPSLLRVQRQLMSLFWHSAGDACVSLAN
PVTYADRLRIRKAGDASFALGPHMDGGSVERWEREGYGRGGVYDSILSGAWEAHDGWDAGRRVEAVNNRYDGLGA
CSVFRAWQGWMAMSSSGPGQGTLLVNPLPKLSTAYVLLRPFFRPVQGNGSIPRDRFLHASNWALMAGEDMTSELQ
GAWPGFGQELSEELHPHLELGRSMVHIPDIRPGDFVAWHCDVIHSVDKIHRGSSDSSVLYIPVCPATEANVEYML
RQREAFRRGTPAPDFPGGEGESRHVGRPDPGEVLAWAPTTEGRQAFGLERMIVRDGAGVGEREAVRRVNDILGL*
Coding >Ophun1|1479
ATGAAGCCTCTCTTGCTCTCAGCTTTCGTCGGCCTCGTCCGCGCCCTCGCTTCGACAGATACCATCACTTGGGGT
GGCGATGGCTCCCGAGCAGGATACCAGCCCAACCACAACATGGACCCAGCCGTCGTCGCCAGCCCCCAGTTCGGC
CAGCTCTTCGGCACTCTCCTCCCAGGGTCCTTCGCCTCGCAGCCGGAGCAAATCTTTTCGCAGCCGCTCGTCTAC
ACGCCCGCTGGAGGCCACCAGTTCGTCTACGTCGCCACGACGCTCAACAATGTCTACAAGCTGGATGCCAGGACG
GGAGCCATCCTCGCCTCGCGAAACCTTCATCTGCCCTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATTAAC
CCGGCTGTGGGCATCATCTCCACCGGCACCATCGATCCGGCTACCGACACCCTCTACCTCACGGCCAAGACGTAC
GTCGATCAGACGCTTGTCGGTCGAGCTCAGGGTCGGCCCGCTGGTCGTTACTATGTTCACGCTCTGGATGTCAAC
GACCTGACTGAGCGTCCCAACTTTCCCGTCAACCTCGAGGGTCTTCTGGCTAGGAACAACCCGTCTCGCATGTTT
ACCGGCGGCATCCACCTCCAACGACCGGCTTTGCTTCTCGCCGGCCAGTACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTCACCGGCTGGATCATAGGCTTGGACAAGTCCTCCGGAGCCGTCGTCGAGCGCTGGGCC
ACCGAGGGCGTCGGTGTGCCCGACACCGTCAGGGGCGGCGGCATTTGGATGTCTGGTGGTGGCCTTTCCTACGAC
GGCGCTGGTTCCATCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACTATTCCCGTCAGGGGGTAT
AACCCGCCCACCTCGCTCGAGGAGGCGGCGCTGCATTTGACGGTGAACTCGGACGGTAGTCTGAGTCTCGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGTGCGGACAAGGACCTCGGCACCAGCCCCCTTGAGATCCTG
CCCGCTCAGTTCGCCTGCGGAGATGTCAAACGCATTGGCGTCGTCACGGCGAAAACCGGCAAGACGTATTGGTTG
AACCTCGATAATCTGGGCGGCTATAGGAATGGAAAGGACGGTTTGGACGACATCATCCAGTCCTATCAAAACGAA
AACTCCGTTTATAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTATGTCTACATCAACGTCATCCAGTATCCG
ACTTCCGTCTTCAAGTTCTCGTGCAACGGAGGCGTGCCCGCCTTCACAAAGGTCGCCGTATCGCCCACGCCCAAC
GCCTACGTTCTCGGTGTCGGCCACGCCTCCGTCACATCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTC
ACCGACGTACAGGGGCCGGGTGTCCGAGTCTACGATGCTGTGCCCAGGGATGGAAGCCTTGTCAGTGTCAACTCG
TTCAACGTTCCCGGCGTCACCAAGTTTTCTCGCGCCGTCTTCGGTGACGGAATCATGTATGTCGGCACGACGAGT
GGCTTCGTCTACGGTTTTGGTTCTCCGGTCAACTCCCCGCTGAACTGCACTTCGCCGCTGGACTTTGGCACCGTC
GACATCAGAGCCACCAGCGACGCCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCACGGGCCTCGGG
CTGGCTGACGGCAAGAACTTTGTTCTGTCCGAGTTGCCGTTGCTTCCTCTGAAGCTGTCACAAGGGCAGTCGTTT
GTCGTGAATGCCAGATTCGGCCCCTCAACCGTCGGCCTCTTGTCGGTCGATATCGTCGCTAACACGACAAACGGG
GCTCCCGGCTTCAGTACGAACACCCACGCGCGCCTGGTCGGGACCGGACGCAGCGCCGGCCCGCTGTTGGCTGTC
AGCCCCAATACCCTTTCGTTCCCCGGCCTCGTCTCCGGTCAGGATCCCAATGGCGTGTCCGAGACGGTCGTCGTC
TCCAATAGGGGTAATGCTGCCCTAAACATTAGATCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCAGACG
TATGACGGCCAGGGAGACCTCCTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAATATGGTGGCTGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTCAACTCGTCTATCAGCGGCACCTTTTCGGCCACAATCAGGTTCATCACCGAC
GGCGGAAACGCAAGCGTCACCATCTACGCTTCGTCTGGGCCGGCTCCCGTCGCTCTGCTCGAGTTCCAGACCATC
GACGGCTTGGGATGGGTGAGATACGAACCCGGAACTCCCTTCAGTTTCGGCAACGTCACGGAGAATACGTCGAGG
TCTCTCAAGTTCCGCATCACCAACGCCGCGCCGACGGGCGGTGTGAAGTTGTCTCTGACGGTGTCGAAACCCCCT
TTCGGCGTCAGTGGCCTGGTCAAGGCTGTCAACCAGATCGACCTGGCCGAGGGCTCCTCGTTCGCGCCAGGGCAG
AGCGCAACGGCGGTGCTGACCTGCACGGCACCCAAGTCCCAGTGGAACGTCGACGCCTACAATGGCACCTCGCAG
TGGACGCTCAACACCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAG
GCGCCGCCATTGCTGCCTGGTGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGT
CAGCTGCCAAACCAGGTCGTTGCCGACGATGGCCTCACCAACGCCATGTGCATCGCCGCGTGTGCCAAGAGCAAC
TACGTCTTCTGCGGCACCGAATACCTGCGCGAGTGCTGGGCCGGCGACCGGATTCCCATGCAAAAAGTCGATGAT
GAGAACTGCAATTACAACTGTGCCGGCTCCATCAACCAGATATGCGGCGGCAACGGCGTCAACGACGGAGCTGGC
GGTGCCTATATATCGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCC
GCCGACAATCCGGGAGTTGCGGGCTTCACTAGCATAGGATGCTATACGGAGGGCAACCCGGGCCGGGCGCTGCCG
AACGGCGTCAACACCGATAAGAGGACGGTGGCTGCGTGTGTGAATGCCTGCAAGGCGGCGACGTTTTCCATGGCC
GGCGTCGAGTACGGAGGCGAGTGCTGGTGCGGGAATGCCCTCGGAACCGGCTCGGTGCCTGCTCCCGCGGCTGAC
TGTGCCATGACGTGCAACGACAACTCGACAGAGTACTGCGGCGGGCCGTCGAGGCTCAATGTTTACCGTCTGGGG
TCTCCCGCAAGCTCGACGTCAACCGGCCCGAGCACGCCCTCAAGCAGCGCCTCACCGCCCAGGACGTCATCCTCG
ACTACGGTCGTCACGACACCCACGACAACCAGTAGCAGCAGCTCATCAGCGCCGACTCCGACCGGACTGGTTGTC
AAGAACACGGTAGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGGCCGGGCCCTGGGCGGAAAC
GCGTACGCGGATGACAAAATGACACTCGAATCTTGCGCCAGTTTCTGCAACGGGTTCCGATACTTTGCCACCGAA
TACGGACGTGAATGCTACTGCGGCGACAGCCTCGGCGGTGGGAGCGTCAAGGCTGTGAACCAGAATGACTGTTCG
TTTCCGTGCGCCGGTGATAGAGCCGCCAAGGTCAAAGGCCATCGGGTTTGGTCGAGCGGCCACAAGAAGGAGGGC
GACATCTCGGACTCGTTTGTCTCCCTCTCTGGGACTGAGCGAGGTGCTTTGCCGGATAGATTCAGGCAGCTCAAG
TGCGAGCTGCTGAGGGCGGAGAATGAGCTTATAGCCCAGAAGGGGTCGGGTGTCATCCCTCAGGTCGACGTCGAG
GATCTTGATGGAGGCTGCGAGGAGAGTGTCAGGGATGAGATTAAGAAGAGAGGGGTTGTTGTCGTCAAGGGGGTG
GTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCGAAGAACCCACAGACCCGAGCC
TTTCCCGCGCACGATCCGCAGGTGTATGAGCTGTACTGGTCCGGCCCCCAGCTCAAGGCACGGGCTCATCCGTCG
CTTCTGCGCGTACAACGGCAACTCATGAGCCTTTTCTGGCACTCTGCCGGCGACGCATGCGTGTCTTTAGCCAAC
CCGGTGACATACGCGGATCGGTTGCGGATCCGGAAGGCCGGCGACGCTTCCTTTGCCTTGGGCCCGCATATGGAT
GGCGGTAGCGTTGAGAGATGGGAGCGTGAGGGCTATGGCCGAGGCGGCGTCTACGATTCGATACTCTCGGGAGCT
TGGGAGGCGCATGATGGCTGGGACGCTGGTCGGAGAGTTGAGGCTGTTAATAACAGGTATGATGGTCTCGGCGCC
TGCTCCGTCTTCCGCGCGTGGCAGGGGTGGATGGCTATGAGCTCGAGTGGTCCGGGGCAGGGGACTTTGCTGGTG
AACCCGTTGCCGAAGCTGTCGACGGCCTACGTTCTGTTGCGGCCGTTCTTCCGGCCGGTGCAAGGAAACGGATCG
ATACCAAGGGATCGGTTCTTGCATGCGTCGAACTGGGCCCTGATGGCTGGGGAGGATATGACGTCTGAGCTTCAG
GGGGCGTGGCCGGGATTCGGTCAGGAGCTGAGTGAGGAGTTGCATCCGCATCTGGAGCTGGGGAGAAGCATGGTG
CATATCCCGGATATAAGGCCCGGAGATTTCGTGGCGTGGCATTGCGATGTCATCCACTCGGTCGACAAGATCCAT
CGCGGCTCATCCGACTCGAGCGTGCTTTACATCCCCGTCTGTCCGGCCACGGAGGCTAACGTCGAGTACATGCTC
CGGCAGCGGGAGGCCTTCCGTCGGGGCACACCGGCGCCTGACTTTCCCGGCGGAGAGGGCGAATCGCGGCACGTG
GGCCGGCCGGATCCGGGAGAGGTCCTTGCTTGGGCTCCGACGACAGAGGGGAGGCAGGCTTTTGGGCTGGAGAGG
ATGATTGTTAGGGATGGGGCGGGGGTTGGGGAGAGGGAGGCGGTTCGGAGGGTGAATGACATTCTCGGACTTTAG
Transcript >Ophun1|1479
ATGAAGCCTCTCTTGCTCTCAGCTTTCGTCGGCCTCGTCCGCGCCCTCGCTTCGACAGATACCATCACTTGGGGT
GGCGATGGCTCCCGAGCAGGATACCAGCCCAACCACAACATGGACCCAGCCGTCGTCGCCAGCCCCCAGTTCGGC
CAGCTCTTCGGCACTCTCCTCCCAGGGTCCTTCGCCTCGCAGCCGGAGCAAATCTTTTCGCAGCCGCTCGTCTAC
ACGCCCGCTGGAGGCCACCAGTTCGTCTACGTCGCCACGACGCTCAACAATGTCTACAAGCTGGATGCCAGGACG
GGAGCCATCCTCGCCTCGCGAAACCTTCATCTGCCCTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATTAAC
CCGGCTGTGGGCATCATCTCCACCGGCACCATCGATCCGGCTACCGACACCCTCTACCTCACGGCCAAGACGTAC
GTCGATCAGACGCTTGTCGGTCGAGCTCAGGGTCGGCCCGCTGGTCGTTACTATGTTCACGCTCTGGATGTCAAC
GACCTGACTGAGCGTCCCAACTTTCCCGTCAACCTCGAGGGTCTTCTGGCTAGGAACAACCCGTCTCGCATGTTT
ACCGGCGGCATCCACCTCCAACGACCGGCTTTGCTTCTCGCCGGCCAGTACCTCTACGCCGGCTTCGCCTCTCAC
TGTGTTCAGTACAACTTCACCGGCTGGATCATAGGCTTGGACAAGTCCTCCGGAGCCGTCGTCGAGCGCTGGGCC
ACCGAGGGCGTCGGTGTGCCCGACACCGTCAGGGGCGGCGGCATTTGGATGTCTGGTGGTGGCCTTTCCTACGAC
GGCGCTGGTTCCATCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACTATTCCCGTCAGGGGGTAT
AACCCGCCCACCTCGCTCGAGGAGGCGGCGCTGCATTTGACGGTGAACTCGGACGGTAGTCTGAGTCTCGTCGAC
TTCTTCATGCCCTGGGAGAAGCAGGCCATGGACGGTGCGGACAAGGACCTCGGCACCAGCCCCCTTGAGATCCTG
CCCGCTCAGTTCGCCTGCGGAGATGTCAAACGCATTGGCGTCGTCACGGCGAAAACCGGCAAGACGTATTGGTTG
AACCTCGATAATCTGGGCGGCTATAGGAATGGAAAGGACGGTTTGGACGACATCATCCAGTCCTATCAAAACGAA
AACTCCGTTTATAGCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTATGTCTACATCAACGTCATCCAGTATCCG
ACTTCCGTCTTCAAGTTCTCGTGCAACGGAGGCGTGCCCGCCTTCACAAAGGTCGCCGTATCGCCCACGCCCAAC
GCCTACGTTCTCGGTGTCGGCCACGCCTCCGTCACATCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTC
ACCGACGTACAGGGGCCGGGTGTCCGAGTCTACGATGCTGTGCCCAGGGATGGAAGCCTTGTCAGTGTCAACTCG
TTCAACGTTCCCGGCGTCACCAAGTTTTCTCGCGCCGTCTTCGGTGACGGAATCATGTATGTCGGCACGACGAGT
GGCTTCGTCTACGGTTTTGGTTCTCCGGTCAACTCCCCGCTGAACTGCACTTCGCCGCTGGACTTTGGCACCGTC
GACATCAGAGCCACCAGCGACGCCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCACGGGCCTCGGG
CTGGCTGACGGCAAGAACTTTGTTCTGTCCGAGTTGCCGTTGCTTCCTCTGAAGCTGTCACAAGGGCAGTCGTTT
GTCGTGAATGCCAGATTCGGCCCCTCAACCGTCGGCCTCTTGTCGGTCGATATCGTCGCTAACACGACAAACGGG
GCTCCCGGCTTCAGTACGAACACCCACGCGCGCCTGGTCGGGACCGGACGCAGCGCCGGCCCGCTGTTGGCTGTC
AGCCCCAATACCCTTTCGTTCCCCGGCCTCGTCTCCGGTCAGGATCCCAATGGCGTGTCCGAGACGGTCGTCGTC
TCCAATAGGGGTAATGCTGCCCTAAACATTAGATCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCAGACG
TATGACGGCCAGGGAGACCTCCTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAATATGGTGGCTGCCAACGCT
GGAAGCGCCATCAACGTGCTCTTCAACTCGTCTATCAGCGGCACCTTTTCGGCCACAATCAGGTTCATCACCGAC
GGCGGAAACGCAAGCGTCACCATCTACGCTTCGTCTGGGCCGGCTCCCGTCGCTCTGCTCGAGTTCCAGACCATC
GACGGCTTGGGATGGGTGAGATACGAACCCGGAACTCCCTTCAGTTTCGGCAACGTCACGGAGAATACGTCGAGG
TCTCTCAAGTTCCGCATCACCAACGCCGCGCCGACGGGCGGTGTGAAGTTGTCTCTGACGGTGTCGAAACCCCCT
TTCGGCGTCAGTGGCCTGGTCAAGGCTGTCAACCAGATCGACCTGGCCGAGGGCTCCTCGTTCGCGCCAGGGCAG
AGCGCAACGGCGGTGCTGACCTGCACGGCACCCAAGTCCCAGTGGAACGTCGACGCCTACAATGGCACCTCGCAG
TGGACGCTCAACACCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAG
GCGCCGCCATTGCTGCCTGGTGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGT
CAGCTGCCAAACCAGGTCGTTGCCGACGATGGCCTCACCAACGCCATGTGCATCGCCGCGTGTGCCAAGAGCAAC
TACGTCTTCTGCGGCACCGAATACCTGCGCGAGTGCTGGGCCGGCGACCGGATTCCCATGCAAAAAGTCGATGAT
GAGAACTGCAATTACAACTGTGCCGGCTCCATCAACCAGATATGCGGCGGCAACGGCGTCAACGACGGAGCTGGC
GGTGCCTATATATCGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCC
GCCGACAATCCGGGAGTTGCGGGCTTCACTAGCATAGGATGCTATACGGAGGGCAACCCGGGCCGGGCGCTGCCG
AACGGCGTCAACACCGATAAGAGGACGGTGGCTGCGTGTGTGAATGCCTGCAAGGCGGCGACGTTTTCCATGGCC
GGCGTCGAGTACGGAGGCGAGTGCTGGTGCGGGAATGCCCTCGGAACCGGCTCGGTGCCTGCTCCCGCGGCTGAC
TGTGCCATGACGTGCAACGACAACTCGACAGAGTACTGCGGCGGGCCGTCGAGGCTCAATGTTTACCGTCTGGGG
TCTCCCGCAAGCTCGACGTCAACCGGCCCGAGCACGCCCTCAAGCAGCGCCTCACCGCCCAGGACGTCATCCTCG
ACTACGGTCGTCACGACACCCACGACAACCAGTAGCAGCAGCTCATCAGCGCCGACTCCGACCGGACTGGTTGTC
AAGAACACGGTAGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGGCCGGGCCCTGGGCGGAAAC
GCGTACGCGGATGACAAAATGACACTCGAATCTTGCGCCAGTTTCTGCAACGGGTTCCGATACTTTGCCACCGAA
TACGGACGTGAATGCTACTGCGGCGACAGCCTCGGCGGTGGGAGCGTCAAGGCTGTGAACCAGAATGACTGTTCG
TTTCCGTGCGCCGGTGATAGAGCCGCCAAGGTCAAAGGCCATCGGGTTTGGTCGAGCGGCCACAAGAAGGAGGGC
GACATCTCGGACTCGTTTGTCTCCCTCTCTGGGACTGAGCGAGGTGCTTTGCCGGATAGATTCAGGCAGCTCAAG
TGCGAGCTGCTGAGGGCGGAGAATGAGCTTATAGCCCAGAAGGGGTCGGGTGTCATCCCTCAGGTCGACGTCGAG
GATCTTGATGGAGGCTGCGAGGAGAGTGTCAGGGATGAGATTAAGAAGAGAGGGGTTGTTGTCGTCAAGGGGGTG
GTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCGAAGAACCCACAGACCCGAGCC
TTTCCCGCGCACGATCCGCAGGTGTATGAGCTGTACTGGTCCGGCCCCCAGCTCAAGGCACGGGCTCATCCGTCG
CTTCTGCGCGTACAACGGCAACTCATGAGCCTTTTCTGGCACTCTGCCGGCGACGCATGCGTGTCTTTAGCCAAC
CCGGTGACATACGCGGATCGGTTGCGGATCCGGAAGGCCGGCGACGCTTCCTTTGCCTTGGGCCCGCATATGGAT
GGCGGTAGCGTTGAGAGATGGGAGCGTGAGGGCTATGGCCGAGGCGGCGTCTACGATTCGATACTCTCGGGAGCT
TGGGAGGCGCATGATGGCTGGGACGCTGGTCGGAGAGTTGAGGCTGTTAATAACAGGTATGATGGTCTCGGCGCC
TGCTCCGTCTTCCGCGCGTGGCAGGGGTGGATGGCTATGAGCTCGAGTGGTCCGGGGCAGGGGACTTTGCTGGTG
AACCCGTTGCCGAAGCTGTCGACGGCCTACGTTCTGTTGCGGCCGTTCTTCCGGCCGGTGCAAGGAAACGGATCG
ATACCAAGGGATCGGTTCTTGCATGCGTCGAACTGGGCCCTGATGGCTGGGGAGGATATGACGTCTGAGCTTCAG
GGGGCGTGGCCGGGATTCGGTCAGGAGCTGAGTGAGGAGTTGCATCCGCATCTGGAGCTGGGGAGAAGCATGGTG
CATATCCCGGATATAAGGCCCGGAGATTTCGTGGCGTGGCATTGCGATGTCATCCACTCGGTCGACAAGATCCAT
CGCGGCTCATCCGACTCGAGCGTGCTTTACATCCCCGTCTGTCCGGCCACGGAGGCTAACGTCGAGTACATGCTC
CGGCAGCGGGAGGCCTTCCGTCGGGGCACACCGGCGCCTGACTTTCCCGGCGGAGAGGGCGAATCGCGGCACGTG
GGCCGGCCGGATCCGGGAGAGGTCCTTGCTTGGGCTCCGACGACAGAGGGGAGGCAGGCTTTTGGGCTGGAGAGG
ATGATTGTTAGGGATGGGGCGGGGGTTGGGGAGAGGGAGGCGGTTCGGAGGGTGAATGACATTCTCGGACTTTAG
Gene >Ophun1|1479
ATGAAGCCTCTCTTGCTCTCAGCTTTCGTCGGCCTCGTCCGCGCCCTCGCTTCGACAGATACCATCACTTGGGGT
GGCGATGGCTCCCGAGCAGGATACCAGCCGTTCGTTCATTCACTTCTCCCCCTTTTTCCTGGCCTTCATCTTTCT
GACTCCGTCTCTCAAGCAACCACAACATGGACCCAGCCGTCGTCGCCAGCCCCCAGTTCGGCCAGCTCTTCGGCA
CTCTCCTCCCAGGGTCCTTCGCCTCGCAGCCGGAGCAAATCTTTTCGCAGCCGCTCGTCTACACGCCCGCTGGAG
GCCACCAGTTCGTCTACGTCGCCACGACGCTCAACAATGTCTACAAGCTGGATGCCAGGACGGGAGCCATCCTCG
CCTCGCGAAACCTTCATCTGCCCTTTCTCGCCGCTGACTTGGACGGCTGCAACGATATTAACCCGGCTGTGGGCA
TCATCTCCACCGGCACCATCGATCCGGCTACCGACACCCTCTACCTCACGGCCAAGACGTACGTCGATCAGACGC
TTGTCGGTCGAGCTCAGGGTCGGCCCGCTGGTCGTTACTATGTTCACGCTCTGGATGTCAACGACCTGACTGAGC
GTCCCAACTTTCCCGTCAACCTCGAGGGTCTTCTGGCTAGGAACAACCCGTCTCGCATGTTTACCGGCGGCATCC
ACCTCCAACGACCGGCTTTGCTTCTCGCCGGCCAGTACCTCTACGCCGGCTTCGCCTCTCACTGTGTTCAGTACA
ACTTCACCGGCTGGATCATAGGCTTGGACAAGTCCTCCGGAGCCGTCGTCGAGCGCTGGGCCACCGAGGGCGTCG
GTGTGCCCGACACCGTCAGGGGCGGCGGCATTTGGATGTCTGGTGGTGGCCTTTCCTACGACGGCGCTGGTTCCA
TCTTCCTCGCCACCGGCAACGGCTATGCCAGCCAGCTCAGCACTATTCCCGTCAGGGGGTATAACCCGCCCACCT
CGCTCGAGGAGGCGGCGCTGCATTTGACGGTGAACTCGGACGGTAGTCTGAGTCTCGTCGACTTCTTCATGCCCT
GGGAGAAGCAGGCCATGGACGGTGCGGACAAGGACCTCGGCACCAGCCCCCTTGAGATCCTGCCCGCTCAGTTCG
CCTGCGGAGATGTCAAACGCATTGGCGTCGTCACGGCGAAAACCGGCAAGACGTATTGGTTGAACCTCGATAATC
TGGGCGGCTATAGGAATGGAAAGGACGGTTTGGACGACATCATCCAGTCCTATCAAAACGAAAACTCCGTTTATA
GCGGCGCCGGCGTCTACCCGCTCGAGGGCGGCTATGTCTACATCAACGTCATCCAGTATCCGACTTCCGTCTTCA
AGTTCTCGTGCAACGGAGGCGTGCCCGCCTTCACAAAGGTCGCCGTATCGCCCACGCCCAACGCCTACGTTCTCG
GTGTCGGCCACGCCTCCGTCACATCCATGGCCGACGAGCCCGGAACTGCCCTCTTATGGGTCACCGACGTACAGG
GGCCGGGTGTCCGAGTCTACGATGCTGTGCCCAGGGATGGAAGCCTTGTCAGTGTCAACTCGTTCAACGTTCCCG
GCGTCACCAAGTTTTCTCGCGCCGTCTTCGGTGACGGAATCATGTATGTCGGCACGACGAGTGGCTTCGTCTACG
GTTTTGGTTCTCCGGTCAACTCCCCGCTGAACTGCACTTCGCCGCTGGACTTTGGCACCGTCGACATCAGAGCCA
CCAGCGACGCCAAGGCCGTCGTCTGCCGGGCCGTCGTCGACCTCACAGTCACGGGCCTCGGGCTGGCTGACGGCA
AGAACTTTGTTCTGTCCGAGTTGCCGTTGCTTCCTCTGAAGCTGTCACAAGGGCAGTCGTTTGTCGTGAATGCCA
GATTCGGCCCCTCAACCGTCGGCCTCTTGTCGGTCGATATCGTCGCTAACACGACAAACGGGGCTCCCGGCTTCA
GTACGAACACCCACGCGCGCCTGGTCGGGACCGGACGCAGCGCCGGCCCGCTGTTGGCTGTCAGCCCCAATACCC
TTTCGTTCCCCGGCCTCGTCTCCGGTCAGGATCCCAATGGCGTGTCCGAGACGGTCGTCGTCTCCAATAGGGGTA
ATGCTGCCCTAAACATTAGATCGATCCTTTATTCCGCCGACAACTCGACGGCGCCTCAGACGTATGACGGCCAGG
GAGACCTCCTCGTCGGACGATTCACGCTTCAGAAGTTGCCCAATATGGTGGCTGCCAACGCTGGAAGCGCCATCA
ACGTGCTCTTCAACTCGTCTATCAGCGGCACCTTTTCGGCCACAATCAGGTTCATCACCGACGGCGGAAACGCAA
GCGTCACCATCTACGCTTCGTCTGGGCCGGCTCCCGTCGCTCTGCTCGAGTTCCAGACCATCGACGGCTTGGGAT
GGGTGAGATACGAACCCGGAACTCCCTTCAGTTTCGGCAACGTCACGGAGAATACGTCGAGGTCTCTCAAGTTCC
GCATCACCAACGCCGCGCCGACGGGCGGTGTGAAGTTGTCTCTGACGGTGTCGAAACCCCCTTTCGGCGTCAGTG
GCCTGGTCAAGGCTGTCAACCAGATCGACCTGGCCGAGGGCTCCTCGTTCGCGCCAGGGCAGAGCGCAACGGCGG
TGCTGACCTGCACGGCACCCAAGTCCCAGTGGAACGTCGACGCCTACAATGGCACCTCGCAGTGGACGCTCAACA
CCAACGACCCCACGCTGGGCAAGCAGTTCGTTCGCTTCTTCTGCAACGCCGTCGCCGAGCAGGCGCCGCCATTGC
TGCCTGGTGGCCGAGGCCAGTATCGTTACGCCGGCTGCTTCAAAGACAACACACCCGAGCGTCAGCTGCCAAACC
AGGTCGTTGCCGACGATGGCCTCACCAACGCCATGTGCATCGCCGCGTGTGCCAAGAGCAACTACGTCTTCTGCG
GCACCGAATACCTGCGCGAGTGCTGGGCCGGCGACCGGATTCCCATGCAAAAAGTCGATGATGAGAACTGCAATT
ACAACTGTGCCGGCTCCATCAACCAGATATGCGGCGGCAACGGCGTCAACGACGGAGCTGGCGGTGCCTATATAT
CGCTCTTCGCCGACTCTCTCCGTTGGGATGGCAACCTTACCAGACCGCCGCCGCCCGGGCCCGCCGACAATCCGG
GAGTTGCGGGCTTCACTAGCATAGGATGCTATACGGAGGGCAACCCGGGCCGGGCGCTGCCGAACGGCGTCAACA
CCGATAAGAGGACGGTGGCTGCGTGTGTGAATGCCTGCAAGGCGGCGACGTTTTCCATGGCCGGCGTCGAGTACG
GAGGCGAGGTGAGTCAGAGTAATACCTCGTCTGATGATTGATCGTGTGCTGACGGTCGCAGTGCTGGTGCGGGAA
TGCCCTCGGAACCGGCTCGGTGCCTGCTCCCGCGGCTGACTGTGCCATGACGTGCAACGGTGAGAGCTCTGTGTG
CCATGTTTGAACAGGCACTGATGCAAAATGATAGACAACTCGACAGAGTACTGCGGCGGGCCGTCGAGGCTCAAT
GTTTACCGTCTGGGGTCTCCCGCAAGCTCGACGTCAACCGGCCCGAGCACGCCCTCAAGCAGCGCCTCACCGCCC
AGGACGTCATCCTCGACTACGGTCGTCACGACACCCACGACAACCAGTAGCAGCAGCTCATCAGCGCCGACTCCG
ACCGGACTGGTTGTCAAGAACACGGTAGGGCGGTACAGCTTCCAGGGATGCTGGACCGAAGCCACCAACGGCCGG
GCCCTGGGCGGAAACGCGTACGCGGATGACAAAATGACACTCGAATCTTGCGCCAGTTTCTGCAACGGGTTCCGA
TACTTTGCCACCGAATACGGACGTGAATGCTACTGCGGCGACAGCCTCGGCGGTGGGAGCGTCAAGGCTGTGAAC
CAGAATGACTGTTCGTTTCCGTGCGCCGGTGATAGGTCCGAGTTTTGTGGTGCGGGTGTTAGACTTGAGCTTTAC
CTGGCGACGGGCTCTTGAGGACATTGACGGGAAGTTGTGATGAGCCGTGGAGTTGAGGGCTATGTATTGATTGAC
AGGGACCTGAAGGGGCGTCGAGGAGTAGTTGAGTTTATCCGCAACTTTGAATGTAACTCACAACACTCTATTAGT
TGAGCGTCTGTGTTGACAACGCAACAAGAGAGCAGACGGACTCATATGGCCCCGAGGACGACGCTGGCTCGGCGT
TTCAAACCCGAAACTCGGCGACGGAGGCGGAGTTCCAAATGGGGTAGCTCCGAGTTGGTTGGACGTTTCCGTTCC
GTCGTTGCCTACAAAAGGGCCTCCAAGCCTGGACTCGAGCCAACGAACACGACGTTGCAGTCTTTGGATACGGCT
CTTGGCATCATGTTACGTCCCCGCTCGAGCTGGCTTCCAAGAGCCGCCAAGGTCAAAGGCCATCGGGTTTGGTCG
AGCGGCCACAAGAAGGAGGGCGACATCTCGGACTCGTTTGTCTCCCTCTCTGGGACTGAGCGAGGTGCTTTGCCG
GATAGATTCAGGCAGCTCAAGTGCGAGCTGGTGAGGGGGCGTGAGAAGAGCTTCGTTGACGGATGGGCGAGGTTG
CTTGGGCAGCTGAGGGCGGAGAATGAGCTTATAGCCCAGAAGGGGTCGGGTGTCATCCCTCAGGTCGACGTCGAG
GATCTTGATGGAGGCTGCGAGGAGAGTGTCAGGGATGAGATTAAGAAGAGAGGGGTTGTTGTCGTCAAGGGGGTG
GTGCCGGAGGATGAGGCCAGGCGATACAAGTTCGAGTTGGATGAGTATATCGCGAAGAACCCACAGACCCGAGGT
GAGAGATCCCCTCTTCATGACCTTCAAAAGTCGTCTAACACGTCGACAGCCTTTCCCGCGCACGATCCGCAGGTG
TATGAGCTGTACTGGTCCGGCCCCCAGCTCAAGGCACGGGCTCATCCGTCGCTTCTGCGCGTACAACGGCAACTC
ATGAGCCTTTTCTGGCACTCTGCCGGCGACGCATGCGTGTCTTTAGCCAACCCGGTGACATACGCGGATCGGTTG
CGGATCCGGAAGGCCGGCGACGCTTCCTTTGCCTTGGGCCCGCATATGGATGGCGGTAGCGTTGAGAGATGGGAG
CGTGAGGGCTATGGCCGAGGCGGCGTCTACGATTCGATACTCTCGGGAGCTTGGGAGGCGCATGATGGCTGGGAC
GCTGGTCGGAGAGTTGAGGCTGTTAATAACAGGTATGATGGTCTCGGCGCCTGCTCCGTCTTCCGCGCGTGGCAG
GGGTGGATGGCTATGAGCTCGAGTGGTCCGGGGCAGGGGACTTTGCTGGTGAACCCGTTGCCGAAGCTGTCGACG
GCCTACGTTCTGTTGCGGCCGTTCTTCCGGCCGGTGCAAGGAAACGGATCGATACCAAGGGATCGGTTCTTGCAT
GCGTCGAACTGGGCCCTGATGGCTGGGGAGGATATGACGTCTGAGCTTCAGGGGGCGTGGCCGGGATTCGGTCAG
GAGCTGAGTGAGGAGTTGCATCCGCATCTGGAGCTGGGGAGAAGCATGGTGCATATCCCGGATATAAGGCCCGGA
GATTTCGTGGCGTGGCATTGCGATGGTGAGTCTCTGTGTCCTCGTCTTGGCTTCCAGCTGACATGGATGGACTCA
AGTCATCCACTCGGTCGACAAGATCCATCGCGGCTCATCCGACTCGAGCGTGCTTTACATCCCCGTCTGTCCGGC
CACGGAGGCTAACGTCGAGTACATGCTCCGGCAGCGGGAGGCCTTCCGTCGGGGCACACCGGCGCCTGACTTTCC
CGGCGGAGAGGGCGAATCGCGGCACGTGGGCCGGCCGGATCCGGGAGAGGTCCTTGCTTGGGCTCCGACGACAGA
GGGGAGGCAGGCTTTTGGGCTGGAGAGGATGATTGTTAGGGATGGGGCGGGGGTTGGGGAGAGGGAGGCGGTTCG
GAGGGTGAATGACATTCTCGGACTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail