Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1476
Gene name
LocationContig_16:49539..51443
Strand-
Gene length (bp)1904
Transcript length (bp)1680
Coding sequence length (bp)1680
Protein length (aa) 560

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00999 Na_H_Exchanger Sodium/hydrogen exchanger family 5.2E-35 18 457

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q99271|NAH1_YEAST Na(+)/H(+) antiporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NHA1 PE=1 SV=1 4 454 3.0E-80
sp|Q99173|NAH1_ZYGRO Na(+)/H(+) antiporter 1 OS=Zygosaccharomyces rouxii GN=SOD2 PE=3 SV=1 4 457 8.0E-78
sp|O42701|NAH2_ZYGRO Na(+)/H(+) antiporter 2 OS=Zygosaccharomyces rouxii GN=SOD22 PE=3 SV=1 4 457 9.0E-77
sp|O14123|NAH2_SCHPO Probable Na(+)/H(+) antiporter C3A11.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod22 PE=1 SV=1 4 454 8.0E-74
sp|P36606|NAH_SCHPO Na(+)/H(+) antiporter OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sod2 PE=1 SV=1 4 457 1.0E-54

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0015299 solute:proton antiporter activity Yes
GO:0006812 cation transport Yes
GO:0051179 localization No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006811 ion transport No
GO:0015291 secondary active transmembrane transporter activity No
GO:0015297 antiporter activity No
GO:0015298 solute:cation antiporter activity No
GO:0022857 transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 34 56 22
3 71 93 22
4 106 128 22
5 237 259 22
6 329 346 17
7 356 374 18
8 394 411 17
9 431 453 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1476
MVTLDVSELNVVLSILGVFIVSYGIISVKIKQRWYLGEAFPAMMVGILLGPVAMKFLDSERWASGEKGQTPAIAL
GVTRVMIGLQLVITGYQLPAKYNLTRWKEMAMCLLPIMTIMWLCTTLCILGTVPKVTLLAALVIGSHVTCTDPIL
SQAIAKGPFADKFVPRHLREIISSEAGANDGFGFPFLMLAVFLIRHADGKAVEGAPKMLLARAAEEGIGRLGGGV
SEALKNWFLETWLYTVTLSVLYGAVVGYGACWGIKRALRNKWIDTESYLLFPSALGMFIVGTCGAIGTDDLLACF
VAGNALNWDGEYLAETERRHDEVNSCIDVLLNFGGFMFIGTIMPWSQFNDPNGTGLTIGRLIGLGCLVILFRRIP
AILISYKLMPSVCKNYKEALFMGYFGPIGAGAVFYVEHTRELFPEPGKGDAEENDLTSLMIPVVYWLVFFSIIVH
GLSIPALNAIYQYFGVKPIQEDPVELRRRSIRVATPPNAVPASRDTFIAFNRFSRPVSEIGLPMTTRDPQPAVGE
EFVVSDKTSEEGSLPFEQIERAPSRPIQPPTSYV*
Coding >Ophun1|1476
ATGGTGACCCTCGACGTGTCGGAGCTCAACGTTGTGCTCTCCATTCTGGGCGTCTTTATTGTGAGCTATGGCATC
ATCTCCGTCAAGATCAAGCAGAGATGGTATCTCGGTGAAGCCTTCCCTGCTATGATGGTGGGCATCCTCCTCGGC
CCTGTAGCCATGAAGTTCCTGGACAGCGAAAGATGGGCGTCTGGAGAAAAGGGGCAGACTCCTGCCATTGCCCTG
GGGGTGACGAGAGTCATGATAGGCCTCCAGCTGGTCATTACCGGCTACCAGCTCCCAGCAAAGTACAACCTAACG
CGCTGGAAGGAAATGGCCATGTGTCTCCTCCCCATCATGACAATCATGTGGCTCTGCACCACGCTTTGCATCCTC
GGCACCGTCCCCAAGGTGACGCTCCTGGCCGCCCTCGTCATCGGCTCCCACGTCACCTGCACGGATCCCATCCTC
TCGCAGGCCATCGCAAAGGGCCCCTTTGCCGACAAGTTTGTGCCGCGCCACCTCCGCGAGATCATCTCCTCCGAG
GCTGGCGCCAACGACGGCTTCGGCTTCCCTTTTCTCATGCTTGCCGTCTTTCTCATCCGTCATGCTGATGGGAAG
GCGGTTGAGGGGGCGCCCAAGATGTTGCTTGCCAGGGCGGCGGAGGAGGGAATCGGGAGGCTGGGGGGTGGTGTC
TCGGAGGCGCTCAAGAATTGGTTCCTTGAGACTTGGCTCTATACCGTCACCTTGTCCGTCTTGTACGGCGCTGTG
GTTGGATACGGTGCCTGCTGGGGCATCAAGAGGGCTCTTCGAAACAAATGGATCGACACAGAATCCTACCTCCTC
TTCCCCTCAGCACTGGGAATGTTCATCGTCGGAACCTGCGGCGCCATCGGCACCGACGACCTCCTCGCCTGCTTC
GTCGCCGGCAACGCCCTCAACTGGGACGGCGAGTATCTGGCCGAGACGGAGCGTCGACACGACGAGGTCAACTCG
TGCATCGACGTGCTCCTCAACTTTGGCGGCTTCATGTTCATCGGCACCATCATGCCCTGGTCTCAGTTCAACGAC
CCCAATGGAACGGGCCTGACCATCGGAAGGCTCATCGGTCTCGGCTGCCTCGTCATCCTCTTCCGTCGCATCCCC
GCCATCCTCATCTCGTACAAGCTCATGCCCTCCGTCTGCAAGAACTACAAAGAGGCCCTCTTCATGGGCTACTTC
GGTCCCATCGGCGCAGGAGCAGTCTTCTACGTCGAACACACCCGCGAACTCTTCCCCGAGCCCGGAAAAGGCGAC
GCCGAAGAAAACGACCTGACAAGCCTCATGATCCCCGTCGTCTACTGGCTCGTCTTCTTCTCCATCATCGTCCAC
GGCCTCTCCATCCCCGCCCTCAACGCCATATACCAATACTTTGGCGTCAAGCCCATCCAAGAAGACCCCGTCGAG
CTACGCCGTCGCTCCATCCGCGTCGCCACGCCTCCCAACGCCGTGCCCGCCAGCAGGGACACCTTCATCGCCTTC
AACCGCTTCAGCAGGCCCGTCTCGGAGATTGGCTTGCCCATGACGACGCGAGATCCGCAGCCGGCTGTCGGCGAG
GAGTTTGTCGTCTCGGATAAGACGTCGGAGGAGGGCAGTCTGCCGTTTGAGCAGATTGAACGGGCGCCGAGTCGG
CCTATCCAGCCTCCGACATCGTACGTTTAG
Transcript >Ophun1|1476
ATGGTGACCCTCGACGTGTCGGAGCTCAACGTTGTGCTCTCCATTCTGGGCGTCTTTATTGTGAGCTATGGCATC
ATCTCCGTCAAGATCAAGCAGAGATGGTATCTCGGTGAAGCCTTCCCTGCTATGATGGTGGGCATCCTCCTCGGC
CCTGTAGCCATGAAGTTCCTGGACAGCGAAAGATGGGCGTCTGGAGAAAAGGGGCAGACTCCTGCCATTGCCCTG
GGGGTGACGAGAGTCATGATAGGCCTCCAGCTGGTCATTACCGGCTACCAGCTCCCAGCAAAGTACAACCTAACG
CGCTGGAAGGAAATGGCCATGTGTCTCCTCCCCATCATGACAATCATGTGGCTCTGCACCACGCTTTGCATCCTC
GGCACCGTCCCCAAGGTGACGCTCCTGGCCGCCCTCGTCATCGGCTCCCACGTCACCTGCACGGATCCCATCCTC
TCGCAGGCCATCGCAAAGGGCCCCTTTGCCGACAAGTTTGTGCCGCGCCACCTCCGCGAGATCATCTCCTCCGAG
GCTGGCGCCAACGACGGCTTCGGCTTCCCTTTTCTCATGCTTGCCGTCTTTCTCATCCGTCATGCTGATGGGAAG
GCGGTTGAGGGGGCGCCCAAGATGTTGCTTGCCAGGGCGGCGGAGGAGGGAATCGGGAGGCTGGGGGGTGGTGTC
TCGGAGGCGCTCAAGAATTGGTTCCTTGAGACTTGGCTCTATACCGTCACCTTGTCCGTCTTGTACGGCGCTGTG
GTTGGATACGGTGCCTGCTGGGGCATCAAGAGGGCTCTTCGAAACAAATGGATCGACACAGAATCCTACCTCCTC
TTCCCCTCAGCACTGGGAATGTTCATCGTCGGAACCTGCGGCGCCATCGGCACCGACGACCTCCTCGCCTGCTTC
GTCGCCGGCAACGCCCTCAACTGGGACGGCGAGTATCTGGCCGAGACGGAGCGTCGACACGACGAGGTCAACTCG
TGCATCGACGTGCTCCTCAACTTTGGCGGCTTCATGTTCATCGGCACCATCATGCCCTGGTCTCAGTTCAACGAC
CCCAATGGAACGGGCCTGACCATCGGAAGGCTCATCGGTCTCGGCTGCCTCGTCATCCTCTTCCGTCGCATCCCC
GCCATCCTCATCTCGTACAAGCTCATGCCCTCCGTCTGCAAGAACTACAAAGAGGCCCTCTTCATGGGCTACTTC
GGTCCCATCGGCGCAGGAGCAGTCTTCTACGTCGAACACACCCGCGAACTCTTCCCCGAGCCCGGAAAAGGCGAC
GCCGAAGAAAACGACCTGACAAGCCTCATGATCCCCGTCGTCTACTGGCTCGTCTTCTTCTCCATCATCGTCCAC
GGCCTCTCCATCCCCGCCCTCAACGCCATATACCAATACTTTGGCGTCAAGCCCATCCAAGAAGACCCCGTCGAG
CTACGCCGTCGCTCCATCCGCGTCGCCACGCCTCCCAACGCCGTGCCCGCCAGCAGGGACACCTTCATCGCCTTC
AACCGCTTCAGCAGGCCCGTCTCGGAGATTGGCTTGCCCATGACGACGCGAGATCCGCAGCCGGCTGTCGGCGAG
GAGTTTGTCGTCTCGGATAAGACGTCGGAGGAGGGCAGTCTGCCGTTTGAGCAGATTGAACGGGCGCCGAGTCGG
CCTATCCAGCCTCCGACATCGTACGTTTAG
Gene >Ophun1|1476
ATGGTGACCCTCGACGTGTCGGAGCTCAACGTTGTGCTCTCCATTCTGGGTGAGTTTTTCTGCCTCGGAGCCGAT
TGTTTGCGTCTGAGAGCTAACAGAGCTGTGCAGGCGTCTTTATTGTGAGCTATGGCATCATCTCCGTCAAGATCA
AGCAGAGATGGTATCTCGGTGAAGCCTGTGAGTGGAATGAGGAGCATGGATGGCGTTGCGCCGCTGACGAGATGG
AGTAGTCCCTGCTATGATGGTGGGCATCCTCCTCGGCCCTGTAGCCATGAAGTTCCTGGACAGCGAAAGATGGGC
GTCTGGAGAAAAGGGGCAGACTCCTGCCATTGCCCTGGTAGGGAAAAGCTCCCAACCTTCGTCGAGACATCATTC
ACTGACGACCAACTTCAGGGGGTGACGAGAGTCATGATAGGCCTCCAGCTGGTCATTACCGGCTACCAGCTCCCA
GCAAAGTACAACCTAACGCGCTGGAAGGAAATGGCCATGTGTCTCCTCCCCATCATGACAATCATGTGGCTCTGC
ACCACGCTTTGCATCCTCGGCACCGTCCCCAAGGTGACGCTCCTGGCCGCCCTCGTCATCGGCTCCCACGTCACC
TGCACGGATCCCATCCTCTCGCAGGCCATCGCAAAGGGCCCCTTTGCCGACAAGTTTGTGCCGCGCCACCTCCGC
GAGATCATCTCCTCCGAGGCTGGCGCCAACGACGGCTTCGGCTTCCCTTTTCTCATGCTTGCCGTCTTTCTCATC
CGTCATGCTGATGGGAAGGCGGTTGAGGGGGCGCCCAAGATGTTGCTTGCCAGGGCGGCGGAGGAGGGAATCGGG
AGGCTGGGGGGTGGTGTCTCGGAGGCGCTCAAGAATTGGTTCCTTGAGACTTGGCTCTATACCGTCACCTTGTCC
GTCTTGTACGGCGCTGTGGTTGGATACGGTGCCTGCTGGGGCATCAAGAGGGCTCTTCGAAAGTGAGATTCCCTT
CCCAAAACACAACCCCCCTTTTCACTAACACGCCCCTCCCCAGCAAATGGATCGACACAGAATCCTACCTCCTCT
TCCCCTCAGCACTGGGAATGTTCATCGTCGGAACCTGCGGCGCCATCGGCACCGACGACCTCCTCGCCTGCTTCG
TCGCCGGCAACGCCCTCAACTGGGACGGCGAGTATCTGGCCGAGACGGAGCGTCGACACGACGAGGTCAACTCGT
GCATCGACGTGCTCCTCAACTTTGGCGGCTTCATGTTCATCGGCACCATCATGCCCTGGTCTCAGTTCAACGACC
CCAATGGAACGGGCCTGACCATCGGAAGGCTCATCGGTCTCGGCTGCCTCGTCATCCTCTTCCGTCGCATCCCCG
CCATCCTCATCTCGTACAAGCTCATGCCCTCCGTCTGCAAGAACTACAAAGAGGCCCTCTTCATGGGCTACTTCG
GTCCCATCGGCGCAGGAGCAGTCTTCTACGTCGAACACACCCGCGAACTCTTCCCCGAGCCCGGAAAAGGCGACG
CCGAAGAAAACGACCTGACAAGCCTCATGATCCCCGTCGTCTACTGGCTCGTCTTCTTCTCCATCATCGTCCACG
GCCTCTCCATCCCCGCCCTCAACGCCATATACCAATACTTTGGCGTCAAGCCCATCCAAGAAGACCCCGTCGAGC
TACGCCGTCGCTCCATCCGCGTCGCCACGCCTCCCAACGCCGTGCCCGCCAGCAGGGACACCTTCATCGCCTTCA
ACCGCTTCAGCAGGCCCGTCTCGGAGATTGGCTTGCCCATGACGACGCGAGATCCGCAGCCGGCTGTCGGCGAGG
AGTTTGTCGTCTCGGATAAGACGTCGGAGGAGGGCAGTCTGCCGTTTGAGCAGATTGAACGGGCGCCGAGTCGGC
CTATCCAGCCTCCGACATCGTACGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail