Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1468
Gene name
LocationContig_16:25524..30489
Strand-
Gene length (bp)4965
Transcript length (bp)4311
Coding sequence length (bp)4311
Protein length (aa) 1437

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 3.0E-28 379 591
PF01061 ABC2_membrane ABC-2 type transporter 2.1E-22 1040 1239
PF00005 ABC_tran ABC transporter 5.2E-22 84 234
PF00005 ABC_tran ABC transporter 1.2E-22 714 872
PF19055 ABC2_membrane_7 ABC-2 type transporter 8.4E-08 901 1009
PF01494 FAD_binding_3 FAD binding domain 1.9E-06 1288 1350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 72 1276 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 79 1292 7.0E-120
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 76 1239 4.0E-99
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 83 1285 1.0E-98
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 65 1252 2.0E-96
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 72 1276 0.0E+00
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 79 1292 7.0E-120
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 76 1239 4.0E-99
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 83 1285 1.0E-98
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 65 1252 2.0E-96
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 67 1275 5.0E-95
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 82 1236 1.0E-93
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 64 1301 1.0E-92
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 20 1163 1.0E-91
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 20 1268 4.0E-91
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 20 1268 9.0E-91
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 83 1244 4.0E-90
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 20 1216 6.0E-90
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 80 1162 1.0E-89
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 83 1259 2.0E-89
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 78 1236 2.0E-89
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 83 1268 3.0E-88
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 83 1267 9.0E-88
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 83 1239 1.0E-87
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 83 1212 1.0E-87
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 20 1268 2.0E-87
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 83 1239 2.0E-87
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 83 1239 2.0E-87
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 11 1252 3.0E-87
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 83 1239 7.0E-87
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 83 1268 1.0E-86
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 83 1215 1.0E-86
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 64 1252 6.0E-86
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 12 1253 1.0E-85
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 37 1239 1.0E-84
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 79 1239 2.0E-84
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 65 1252 2.0E-84
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 20 1163 6.0E-84
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 83 1244 8.0E-84
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 20 1167 1.0E-83
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 65 1253 3.0E-83
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 83 1236 1.0E-82
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 83 1239 4.0E-82
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 83 958 1.0E-81
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 65 1252 4.0E-81
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 80 1244 4.0E-81
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 83 1239 1.0E-80
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 83 1153 3.0E-80
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 16 1215 3.0E-80
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 55 1239 5.0E-80
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 68 1237 9.0E-80
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 25 654 4.0E-79
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 80 1252 5.0E-79
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 25 654 1.0E-78
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 83 1252 3.0E-78
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 65 1236 3.0E-78
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 80 1153 3.0E-78
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 83 1198 2.0E-77
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 69 654 2.0E-77
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 83 1252 8.0E-77
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 91 1273 8.0E-77
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 83 1255 1.0E-76
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 43 654 2.0E-76
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 69 1178 3.0E-76
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 15 655 6.0E-76
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 29 650 2.0E-75
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 3 1246 2.0E-75
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 69 654 3.0E-75
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 83 1239 5.0E-75
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 711 1272 7.0E-75
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 711 1272 1.0E-74
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 43 610 2.0E-74
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 83 1186 4.0E-73
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 27 1276 5.0E-73
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 82 1174 1.0E-71
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 99 1255 3.0E-71
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 16 1239 3.0E-70
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 96 596 4.0E-69
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 711 1272 2.0E-68
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 83 653 3.0E-68
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 96 596 5.0E-68
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 83 654 1.0E-67
sp|Q7TMS5|ABCG2_MOUSE ATP-binding cassette sub-family G member 2 OS=Mus musculus GN=Abcg2 PE=1 SV=1 700 1246 2.0E-67
sp|Q80W57|ABCG2_RAT ATP-binding cassette sub-family G member 2 OS=Rattus norvegicus GN=Abcg2 PE=1 SV=1 700 1280 2.0E-67
sp|Q4GZT4|ABCG2_BOVIN ATP-binding cassette sub-family G member 2 OS=Bos taurus GN=ABCG2 PE=3 SV=2 703 1280 3.0E-67
sp|Q9DBM0|ABCG8_MOUSE ATP-binding cassette sub-family G member 8 OS=Mus musculus GN=Abcg8 PE=2 SV=1 718 1200 3.0E-67
sp|Q5MB13|ABCG2_MACMU ATP-binding cassette sub-family G member 2 OS=Macaca mulatta GN=ABCG2 PE=2 SV=1 703 1280 2.0E-66
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 58 592 1.0E-65
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 13 599 1.0E-65
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 83 610 2.0E-65
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 13 592 5.0E-65
sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 703 1272 6.0E-65
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 79 597 5.0E-64
sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 700 1280 9.0E-64
sp|Q99PE7|ABCG5_RAT ATP-binding cassette sub-family G member 5 OS=Rattus norvegicus GN=Abcg5 PE=2 SV=3 83 598 3.0E-63
sp|Q9ZU35|AB7G_ARATH ABC transporter G family member 7 OS=Arabidopsis thaliana GN=ABCG7 PE=2 SV=1 685 1272 4.0E-63
sp|Q9H222|ABCG5_HUMAN ATP-binding cassette sub-family G member 5 OS=Homo sapiens GN=ABCG5 PE=1 SV=1 80 598 4.0E-63
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 83 623 4.0E-63
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 709 1279 5.0E-63
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 41 654 4.0E-62
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 709 1235 4.0E-62
sp|Q99PE8|ABCG5_MOUSE ATP-binding cassette sub-family G member 5 OS=Mus musculus GN=Abcg5 PE=1 SV=1 83 598 6.0E-62
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 680 962 1.0E-61
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 709 1239 2.0E-61
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 375 961 3.0E-61
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 711 1244 3.0E-61
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 83 652 4.0E-61
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 57 593 4.0E-61
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 83 654 8.0E-61
sp|Q93YS4|AB22G_ARATH ABC transporter G family member 22 OS=Arabidopsis thaliana GN=ABCG22 PE=1 SV=1 710 1230 9.0E-61
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 83 652 9.0E-61
sp|P58428|ABCG8_RAT ATP-binding cassette sub-family G member 8 OS=Rattus norvegicus GN=Abcg8 PE=2 SV=2 718 1210 3.0E-60
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 144 1315 3.0E-60
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 70 1159 3.0E-60
sp|Q9H221|ABCG8_HUMAN ATP-binding cassette sub-family G member 8 OS=Homo sapiens GN=ABCG8 PE=1 SV=1 718 1200 5.0E-60
sp|Q9FT51|AB27G_ARATH ABC transporter G family member 27 OS=Arabidopsis thaliana GN=ABCG27 PE=2 SV=1 710 1185 6.0E-60
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 83 652 3.0E-59
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 80 601 5.0E-59
sp|Q11180|WHT1_CAEEL ABC transporter ATP-binding protein/permease wht-1 OS=Caenorhabditis elegans GN=wht-1 PE=2 SV=2 711 1299 1.0E-58
sp|P10090|WHITE_DROME Protein white OS=Drosophila melanogaster GN=w PE=2 SV=2 709 1235 1.0E-58
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 709 1272 2.0E-58
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 6 591 7.0E-58
sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 710 1237 9.0E-58
sp|Q7XA72|AB21G_ARATH ABC transporter G family member 21 OS=Arabidopsis thaliana GN=ABCG21 PE=2 SV=2 709 1268 9.0E-58
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 66 629 9.0E-58
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 711 1239 1.0E-57
sp|Q27256|WHITE_ANOGA Protein white OS=Anopheles gambiae GN=w PE=2 SV=1 40 652 2.0E-57
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 83 591 3.0E-57
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 80 597 4.0E-57
sp|Q84TH5|AB25G_ARATH ABC transporter G family member 25 OS=Arabidopsis thaliana GN=ABCG25 PE=2 SV=1 711 1156 7.0E-57
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 58 583 7.0E-57
sp|Q9SZR9|AB9G_ARATH ABC transporter G family member 9 OS=Arabidopsis thaliana GN=ABCG9 PE=3 SV=2 666 1159 1.0E-56
sp|Q9M2V7|AB16G_ARATH ABC transporter G family member 16 OS=Arabidopsis thaliana GN=ABCG16 PE=2 SV=2 29 591 1.0E-56
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 662 1244 3.0E-56
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 696 1246 3.0E-56
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 729 1234 3.0E-56
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 65 1139 3.0E-56
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 662 1244 4.0E-56
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 711 1245 4.0E-56
sp|Q9LK50|AB26G_ARATH ABC transporter G family member 26 OS=Arabidopsis thaliana GN=ABCG26 PE=3 SV=2 711 1237 5.0E-56
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 694 1239 6.0E-56
sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 711 1278 7.0E-56
sp|Q8H8V7|AB5G_ORYSJ ABC transporter G family member 5 OS=Oryza sativa subsp. japonica GN=RCN1 PE=1 SV=1 27 591 1.0E-55
sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 709 1272 2.0E-55
sp|B8ALI0|AB5G_ORYSI ABC transporter G family member 5 OS=Oryza sativa subsp. indica GN=OsI_11044 PE=3 SV=1 27 591 2.0E-55
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 83 583 2.0E-55
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 83 645 2.0E-55
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 83 317 4.0E-55
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 25 650 5.0E-55
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 83 583 6.0E-55
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 83 583 1.0E-54
sp|Q9ZUT0|AB2G_ARATH ABC transporter G family member 2 OS=Arabidopsis thaliana GN=ABCG2 PE=2 SV=1 76 593 2.0E-54
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 83 650 2.0E-54
sp|Q16928|WHITE_ANOAL Protein white OS=Anopheles albimanus GN=W PE=3 SV=1 83 652 3.0E-54
sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 705 1277 1.0E-53
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 66 627 4.0E-53
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 13 654 5.0E-53
sp|Q9LFG8|AB20G_ARATH ABC transporter G family member 20 OS=Arabidopsis thaliana GN=ABCG20 PE=2 SV=1 79 592 7.0E-53
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 66 650 7.0E-53
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 59 654 9.0E-53
sp|Q9C8K2|AB12G_ARATH ABC transporter G family member 12 OS=Arabidopsis thaliana GN=ABCG12 PE=1 SV=1 709 1272 1.0E-52
sp|Q05360|WHITE_LUCCU Protein white OS=Lucilia cuprina GN=W PE=2 SV=2 83 591 2.0E-52
sp|Q17320|WHITE_CERCA Protein white OS=Ceratitis capitata GN=W PE=2 SV=1 93 652 3.0E-52
sp|Q9M3D6|AB19G_ARATH ABC transporter G family member 19 OS=Arabidopsis thaliana GN=ABCG19 PE=1 SV=1 83 591 3.0E-52
sp|Q9M2V5|AB18G_ARATH ABC transporter G family member 18 OS=Arabidopsis thaliana GN=ABCG18 PE=2 SV=1 711 1239 1.0E-51
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 711 1244 2.0E-51
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 706 1273 5.0E-51
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 706 1307 6.0E-51
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 83 650 9.0E-51
sp|O80946|AB1G_ARATH ABC transporter G family member 1 OS=Arabidopsis thaliana GN=ABCG1 PE=2 SV=1 40 317 1.0E-50
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 7 654 3.0E-50
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 7 654 3.0E-50
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 11 654 3.0E-50
sp|Q9SIT6|AB5G_ARATH ABC transporter G family member 5 OS=Arabidopsis thaliana GN=ABCG5 PE=2 SV=1 83 594 4.0E-50
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 83 650 8.0E-50
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 79 654 1.0E-49
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 59 650 1.0E-49
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 11 650 2.0E-49
sp|Q9FNB5|AB6G_ARATH ABC transporter G family member 6 OS=Arabidopsis thaliana GN=ABCG6 PE=2 SV=1 20 591 2.0E-49
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 83 650 3.0E-49
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 488 1236 5.0E-49
sp|Q08234|YO075_YEAST Uncharacterized ABC transporter ATP-binding protein/permease YOL075C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL075C PE=1 SV=3 665 992 9.0E-49
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 83 591 2.0E-48
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 45 1255 2.0E-48
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 39 654 4.0E-48
sp|Q9M2V6|AB17G_ARATH ABC transporter G family member 17 OS=Arabidopsis thaliana GN=ABCG17 PE=2 SV=1 711 1159 4.0E-48
sp|Q55DA0|ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum GN=abcG22 PE=2 SV=1 679 1251 6.0E-48
sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=1 SV=1 706 1279 7.0E-48
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 65 650 2.0E-47
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 79 582 6.0E-47
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 79 645 6.0E-47
sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 663 1279 7.0E-47
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 79 582 1.0E-46
sp|Q8T686|ABCG7_DICDI ABC transporter G family member 7 OS=Dictyostelium discoideum GN=abcG7 PE=3 SV=1 679 1277 1.0E-46
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 11 654 2.0E-46
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 712 1277 2.0E-46
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 83 642 3.0E-46
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 712 1277 5.0E-46
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 710 1188 5.0E-46
sp|Q3E9B8|AB23G_ARATH ABC transporter G family member 23 OS=Arabidopsis thaliana GN=ABCG23 PE=2 SV=1 713 1279 1.0E-45
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 687 958 1.0E-45
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 52 654 2.0E-45
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 63 333 2.0E-45
sp|Q09466|WHT3_CAEEL ABC transporter ATP-binding protein/permease wht-3 OS=Caenorhabditis elegans GN=wht-3 PE=3 SV=1 700 1240 3.0E-45
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 83 654 1.0E-44
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 83 629 1.0E-44
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 83 368 1.0E-44
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 83 652 2.0E-44
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 79 650 2.0E-44
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 59 650 3.0E-44
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 83 576 3.0E-44
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 65 597 6.0E-44
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 83 646 8.0E-44
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 9 591 8.0E-44
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 59 587 9.0E-44
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 711 1279 9.0E-44
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 52 591 1.0E-43
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 83 324 1.0E-43
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 711 956 1.0E-43
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 711 1246 3.0E-43
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 711 1275 4.0E-43
sp|Q9C8J8|AB13G_ARATH ABC transporter G family member 13 OS=Arabidopsis thaliana GN=ABCG13 PE=2 SV=1 711 1157 6.0E-43
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 83 576 9.0E-43
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 706 1312 2.0E-42
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 59 650 2.0E-42
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 83 652 3.0E-42
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 59 637 4.0E-42
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 83 652 4.0E-42
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 83 638 1.0E-41
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 61 567 1.0E-41
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 38 605 1.0E-41
sp|Q8T689|ABCG4_DICDI ABC transporter G family member 4 OS=Dictyostelium discoideum GN=abcG4 PE=3 SV=1 712 992 2.0E-41
sp|Q9SW08|AB4G_ARATH ABC transporter G family member 4 OS=Arabidopsis thaliana GN=ABCG4 PE=3 SV=1 720 1251 5.0E-41
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 711 1261 8.0E-41
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 80 591 2.0E-40
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 83 612 2.0E-40
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 79 648 2.0E-40
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 27 319 2.0E-40
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 710 1252 2.0E-40
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 64 654 3.0E-40
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 50 626 3.0E-40
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 50 573 3.0E-40
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 47 654 5.0E-40
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 83 559 1.0E-39
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 83 317 1.0E-39
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 711 957 4.0E-39
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 726 1179 5.0E-39
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 83 573 8.0E-39
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 83 631 1.0E-38
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 80 591 3.0E-38
sp|Q9FLX5|AB8G_ARATH ABC transporter G family member 8 OS=Arabidopsis thaliana GN=ABCG8 PE=2 SV=1 722 1268 3.0E-38
sp|Q9MAG3|AB24G_ARATH ABC transporter G family member 24 OS=Arabidopsis thaliana GN=ABCG24 PE=2 SV=2 83 317 6.0E-38
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 710 1257 3.0E-37
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 726 1293 4.0E-37
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 726 1277 5.0E-37
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 83 623 9.0E-37
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 678 1264 1.0E-36
sp|Q9SJK6|WBC30_ARATH Putative white-brown complex homolog protein 30 OS=Arabidopsis thaliana GN=WBC30 PE=1 SV=3 702 957 1.0E-36
sp|Q99P81|ABCG3_MOUSE ATP-binding cassette sub-family G member 3 OS=Mus musculus GN=Abcg3 PE=1 SV=2 96 629 2.0E-36
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 83 536 8.0E-36
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 650 1260 2.0E-35
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 642 1244 1.0E-33
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 83 623 3.0E-33
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 52 631 3.0E-32
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 52 598 3.0E-32
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 713 1260 6.0E-32
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 83 623 7.0E-32
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 690 1159 1.0E-31
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 51 317 1.0E-31
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 697 1235 8.0E-31
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 695 1246 9.0E-31
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 78 603 2.0E-30
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 681 1260 2.0E-30
sp|Q9FF46|AB28G_ARATH ABC transporter G family member 28 OS=Arabidopsis thaliana GN=ABCG28 PE=3 SV=1 702 957 2.0E-30
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 94 581 3.0E-30
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 673 1244 5.0E-30
sp|Q9ZUU9|AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana GN=ABCG3 PE=1 SV=2 702 1192 5.0E-30
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 78 620 1.0E-29
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 69 320 3.0E-29
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 701 1235 4.0E-29
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 694 957 4.0E-29
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 94 581 6.0E-29
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 698 1250 3.0E-28
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 706 1277 1.0E-27
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 671 1248 2.0E-27
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 706 1248 2.0E-27
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 713 1260 2.0E-27
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 713 1260 2.0E-27
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 728 1260 4.0E-27
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 91 598 5.0E-27
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 686 1235 6.0E-27
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 706 1244 6.0E-27
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 708 1250 8.0E-27
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 698 1260 1.0E-26
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 713 1244 1.0E-26
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 701 1338 2.0E-26
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 712 1248 2.0E-26
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 706 1251 3.0E-26
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 634 1260 4.0E-26
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 711 928 6.0E-26
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 698 1246 1.0E-25
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 703 1244 1.0E-25
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 685 1248 1.0E-25
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 676 1361 3.0E-25
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 83 297 3.0E-25
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 682 958 4.0E-25
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 703 1271 4.0E-25
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 713 1260 6.0E-25
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 673 1275 1.0E-24
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 636 1260 5.0E-24
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 703 952 6.0E-24
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 703 1235 9.0E-24
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 681 1260 2.0E-23
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 703 1244 3.0E-23
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 708 1248 6.0E-23
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 83 269 5.0E-22
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 713 911 3.0E-21
sp|P12428|BROWN_DROME Protein brown OS=Drosophila melanogaster GN=bw PE=2 SV=1 83 269 6.0E-21
sp|Q24739|BROWN_DROVI Protein brown OS=Drosophila virilis GN=bw PE=2 SV=1 713 912 3.0E-20
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 83 305 4.0E-20
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 783 1252 1.0E-19
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 713 920 6.0E-19
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 703 924 7.0E-19
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 360 652 1.0E-18
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 96 289 1.0E-18
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 704 935 3.0E-18
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 708 1253 4.0E-18
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 714 936 6.0E-18
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 713 920 6.0E-18
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 713 920 1.0E-17
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 707 934 2.0E-17
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 94 289 3.0E-17
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 710 938 5.0E-17
sp|Q9V2E4|Y130_PYRAB Putative ABC transporter ATP-binding protein PYRAB01300 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01300 PE=3 SV=1 711 933 6.0E-17
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 706 901 8.0E-17
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 711 916 8.0E-17
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 711 916 1.0E-16
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 98 290 1.0E-16
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 714 936 2.0E-16
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 706 959 2.0E-16
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 712 905 2.0E-16
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 711 916 3.0E-16
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 711 916 3.0E-16
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 711 916 3.0E-16
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 71 290 4.0E-16
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 706 959 5.0E-16
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 704 932 5.0E-16
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 711 927 6.0E-16
sp|P44986|THIQ_HAEIN Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiQ PE=1 SV=2 708 920 6.0E-16
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 711 916 6.0E-16
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 93 290 7.0E-16
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 711 916 7.0E-16
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 711 916 7.0E-16
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 93 290 9.0E-16
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 93 290 9.0E-16
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 93 290 9.0E-16
sp|Q8SQU5|YBD4_ENCCU ABC transporter-like protein ECU11_1340 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU11_1340 PE=1 SV=1 713 974 1.0E-15
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 712 929 1.0E-15
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 90 340 1.0E-15
sp|Q21GS5|MODC_SACD2 Molybdenum import ATP-binding protein ModC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=modC PE=3 SV=1 82 296 1.0E-15
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 98 290 2.0E-15
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 706 959 2.0E-15
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 714 920 2.0E-15
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 713 902 2.0E-15
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 90 341 2.0E-15
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 652 908 2.0E-15
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 96 289 3.0E-15
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 72 312 3.0E-15
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 83 266 3.0E-15
sp|O34697|BCEA_BACSU Bacitracin export ATP-binding protein BceA OS=Bacillus subtilis (strain 168) GN=bceA PE=2 SV=1 701 901 3.0E-15
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 713 931 3.0E-15
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 714 927 3.0E-15
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 711 916 3.0E-15
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 78 264 3.0E-15
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 78 264 3.0E-15
sp|Q6D7D0|MODC_PECAS Molybdenum import ATP-binding protein ModC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=modC PE=3 SV=1 84 284 3.0E-15
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 82 266 3.0E-15
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 711 933 3.0E-15
sp|Q4QLQ1|THIQ_HAEI8 Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain 86-028NP) GN=thiQ PE=3 SV=2 708 920 4.0E-15
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 84 290 4.0E-15
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 706 920 4.0E-15
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 95 283 5.0E-15
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 86 283 5.0E-15
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 80 293 6.0E-15
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 711 933 6.0E-15
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 86 289 6.0E-15
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 96 289 6.0E-15
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 712 924 6.0E-15
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 710 935 6.0E-15
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 713 902 7.0E-15
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 704 902 7.0E-15
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 83 264 7.0E-15
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 705 901 7.0E-15
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 713 938 7.0E-15
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 713 927 9.0E-15
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 706 932 9.0E-15
sp|Q58903|Y1508_METJA Uncharacterized ABC transporter ATP-binding protein MJ1508 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1508 PE=3 SV=1 81 265 1.0E-14
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 706 932 1.0E-14
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 83 264 1.0E-14
sp|Q66D71|MODC_YERPS Molybdenum import ATP-binding protein ModC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=modC PE=3 SV=1 84 284 1.0E-14
sp|Q1CFP9|MODC_YERPN Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=modC PE=3 SV=1 84 284 1.0E-14
sp|Q8ZGX6|MODC_YERPE Molybdenum import ATP-binding protein ModC OS=Yersinia pestis GN=modC PE=3 SV=1 84 284 1.0E-14
sp|Q1C951|MODC_YERPA Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=modC PE=3 SV=1 84 284 1.0E-14
sp|Q664P8|TAUB_YERPS Taurine import ATP-binding protein TauB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tauB PE=3 SV=1 711 920 1.0E-14
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 83 264 1.0E-14
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 68 262 1.0E-14
sp|Q1I7I9|MACB2_PSEE4 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas entomophila (strain L48) GN=macB2 PE=3 SV=1 83 264 1.0E-14
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 713 924 1.0E-14
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 713 902 1.0E-14
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 713 902 1.0E-14
sp|Q1CCR9|TAUB_YERPN Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tauB PE=3 SV=1 711 920 1.0E-14
sp|Q8ZJD0|TAUB_YERPE Taurine import ATP-binding protein TauB OS=Yersinia pestis GN=tauB PE=3 SV=1 711 920 1.0E-14
sp|Q1C2S1|TAUB_YERPA Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tauB PE=3 SV=1 711 920 1.0E-14
sp|O34979|YVRO_BACSU Uncharacterized ABC transporter ATP-binding protein YvrO OS=Bacillus subtilis (strain 168) GN=yvrO PE=3 SV=2 79 266 2.0E-14
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 709 908 2.0E-14
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 710 902 2.0E-14
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 711 916 2.0E-14
sp|Q4K9A4|MACB2_PSEF5 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB2 PE=3 SV=1 69 264 2.0E-14
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 707 936 2.0E-14
sp|Q88G95|MODC_PSEPK Molybdenum import ATP-binding protein ModC OS=Pseudomonas putida (strain KT2440) GN=modC PE=3 SV=1 87 289 2.0E-14
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 704 947 2.0E-14
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 704 947 2.0E-14
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 91 289 2.0E-14
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 83 286 2.0E-14
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 714 981 2.0E-14
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 81 264 2.0E-14
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 706 965 2.0E-14
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 84 315 2.0E-14
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 668 902 2.0E-14
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 83 291 2.0E-14
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 83 291 2.0E-14
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 714 934 2.0E-14
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 713 902 2.0E-14
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 717 937 2.0E-14
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 717 937 2.0E-14
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 717 937 2.0E-14
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 717 937 2.0E-14
sp|Q3SJC6|MODC_THIDA Molybdenum import ATP-binding protein ModC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=modC PE=3 SV=1 86 283 3.0E-14
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 68 262 3.0E-14
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 68 262 3.0E-14
sp|Q6N0P7|MODC_RHOPA Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=modC PE=3 SV=1 91 292 3.0E-14
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 84 290 3.0E-14
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 704 932 3.0E-14
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 728 886 3.0E-14
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 87 292 3.0E-14
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 83 283 3.0E-14
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 704 929 4.0E-14
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 717 937 4.0E-14
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 713 966 4.0E-14
sp|P96605|YDBJ_BACSU Uncharacterized ABC transporter ATP-binding protein YdbJ OS=Bacillus subtilis (strain 168) GN=ydbJ PE=3 SV=1 704 946 4.0E-14
sp|Q6FYL0|MACB_BARQU Macrolide export ATP-binding/permease protein MacB OS=Bartonella quintana (strain Toulouse) GN=macB PE=3 SV=1 712 901 4.0E-14
sp|Q4FU75|MACB_PSYA2 Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=macB PE=3 SV=1 80 266 4.0E-14
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 706 901 4.0E-14
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 704 928 4.0E-14
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 714 922 4.0E-14
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 688 933 4.0E-14
sp|Q3KC21|MODC_PSEPF Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf0-1) GN=modC PE=3 SV=1 87 289 4.0E-14
sp|Q6NA00|PHNC2_RHOPA Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=phnC2 PE=3 SV=1 83 315 4.0E-14
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 710 902 5.0E-14
sp|P37732|MODC1_AZOVI Molybdenum import ATP-binding protein ModC 1 OS=Azotobacter vinelandii GN=modC1 PE=3 SV=2 86 290 5.0E-14
sp|Q2VZJ1|CCMA_MAGSA Cytochrome c biogenesis ATP-binding export protein CcmA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ccmA PE=3 SV=1 711 901 5.0E-14
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 83 283 5.0E-14
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 713 924 5.0E-14
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 706 920 5.0E-14
sp|Q6G1V5|MACB_BARHE Macrolide export ATP-binding/permease protein MacB OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=macB PE=3 SV=1 83 286 5.0E-14
sp|Q6LHL2|MODC_PHOPR Molybdenum import ATP-binding protein ModC OS=Photobacterium profundum GN=modC PE=3 SV=1 86 284 5.0E-14
sp|A1U0A9|MACB_MARHV Macrolide export ATP-binding/permease protein MacB OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=macB PE=3 SV=1 713 901 6.0E-14
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 710 979 6.0E-14
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 78 264 6.0E-14
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 713 924 6.0E-14
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 83 325 6.0E-14
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 714 934 6.0E-14
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 87 292 7.0E-14
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 709 908 7.0E-14
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 80 290 7.0E-14
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 66 265 7.0E-14
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 728 901 7.0E-14
sp|Q1IGM2|TAUB_PSEE4 Taurine import ATP-binding protein TauB OS=Pseudomonas entomophila (strain L48) GN=tauB PE=3 SV=1 80 264 8.0E-14
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 709 908 8.0E-14
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 713 938 8.0E-14
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 711 903 8.0E-14
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 19 326 9.0E-14
sp|Q47CB7|MODC_DECAR Molybdenum import ATP-binding protein ModC OS=Dechloromonas aromatica (strain RCB) GN=modC PE=3 SV=1 87 296 9.0E-14
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 80 305 1.0E-13
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 83 265 1.0E-13
sp|Q6G1V5|MACB_BARHE Macrolide export ATP-binding/permease protein MacB OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=macB PE=3 SV=1 712 901 1.0E-13
sp|Q2K2X0|MODC_RHIEC Molybdenum import ATP-binding protein ModC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=modC PE=3 SV=1 96 296 1.0E-13
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 713 916 1.0E-13
sp|Q4KES7|MACB1_PSEF5 Macrolide export ATP-binding/permease protein MacB 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB1 PE=3 SV=1 84 285 1.0E-13
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 84 290 1.0E-13
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 714 947 1.0E-13
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 99 344 1.0E-13
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 710 920 1.0E-13
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 672 901 1.0E-13
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 83 296 1.0E-13
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 704 901 1.0E-13
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 704 901 1.0E-13
sp|Q1QDA8|MACB_PSYCK Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter cryohalolentis (strain K5) GN=macB PE=3 SV=1 80 266 1.0E-13
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 68 262 1.0E-13
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 68 262 1.0E-13
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 68 262 1.0E-13
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 713 886 1.0E-13
sp|O69063|HTXD_PSEST Hypophosphite import ATP-binding protein HtxD OS=Pseudomonas stutzeri GN=htxD PE=3 SV=1 691 927 1.0E-13
sp|Q8TYV9|Y182_METKA Putative ABC transporter ATP-binding protein MK0182 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=MK0182 PE=3 SV=1 728 933 1.0E-13
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 704 901 1.0E-13
sp|Q8CMU4|PHNC_STAES Phosphonates import ATP-binding protein PhnC OS=Staphylococcus epidermidis (strain ATCC 12228) GN=phnC PE=3 SV=1 714 931 1.0E-13
sp|Q5HKQ8|PHNC_STAEQ Phosphonates import ATP-binding protein PhnC OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=phnC PE=3 SV=1 714 931 1.0E-13
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 714 920 2.0E-13
sp|Q8PP41|SSUB1_XANAC Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ssuB1 PE=3 SV=1 80 285 2.0E-13
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 96 283 2.0E-13
sp|Q82VK1|MACB_NITEU Macrolide export ATP-binding/permease protein MacB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=macB PE=3 SV=1 83 264 2.0E-13
sp|Q5E0T4|MODC_VIBF1 Molybdenum import ATP-binding protein ModC OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=modC PE=3 SV=1 83 314 2.0E-13
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 87 289 2.0E-13
sp|Q0K9I2|SSUB_CUPNH Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssuB PE=3 SV=1 79 283 2.0E-13
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 714 908 2.0E-13
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 714 908 2.0E-13
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 709 908 2.0E-13
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 84 264 2.0E-13
sp|Q3KE48|MACB2_PSEPF Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=macB2 PE=3 SV=1 84 267 2.0E-13
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 706 920 2.0E-13
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 79 287 2.0E-13
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 83 266 2.0E-13
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 87 330 2.0E-13
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 64 296 2.0E-13
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 79 264 2.0E-13
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 81 295 2.0E-13
sp|Q9KGD6|ECFA2_BACHD Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=ecfA2 PE=3 SV=1 710 927 2.0E-13
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 714 933 2.0E-13
sp|P0AAG3|GLTL_ECOLI Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli (strain K12) GN=gltL PE=3 SV=1 731 902 2.0E-13
sp|P0AAG4|GLTL_ECO57 Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli O157:H7 GN=gltL PE=3 SV=1 731 902 2.0E-13
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 712 901 2.0E-13
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 84 290 2.0E-13
sp|Q6AMR9|LOLD_DESPS Lipoprotein-releasing system ATP-binding protein LolD OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lolD PE=3 SV=1 71 284 2.0E-13
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 706 887 3.0E-13
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 84 346 3.0E-13
sp|Q83LR7|MACB_SHIFL Macrolide export ATP-binding/permease protein MacB OS=Shigella flexneri GN=macB PE=3 SV=1 79 267 3.0E-13
sp|P63374|PSTB1_STRR6 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pstB1 PE=3 SV=1 710 899 3.0E-13
sp|P63373|PSTB1_STRPN Phosphate import ATP-binding protein PstB 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pstB1 PE=3 SV=1 710 899 3.0E-13
sp|Q4L9P7|PHNC_STAHJ Phosphonates import ATP-binding protein PhnC OS=Staphylococcus haemolyticus (strain JCSC1435) GN=phnC PE=3 SV=1 714 931 3.0E-13
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 93 264 3.0E-13
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 711 902 3.0E-13
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 86 292 3.0E-13
sp|P96117|TROB_TREPA Zinc transport system ATP-binding protein TroB OS=Treponema pallidum (strain Nichols) GN=troB PE=3 SV=1 688 917 3.0E-13
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 704 932 3.0E-13
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 81 267 3.0E-13
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 714 902 3.0E-13
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 729 932 3.0E-13
sp|P75831|MACB_ECOLI Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain K12) GN=macB PE=1 SV=1 713 938 3.0E-13
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 714 942 3.0E-13
sp|Q31ZH4|LOLD_SHIBS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella boydii serotype 4 (strain Sb227) GN=lolD PE=3 SV=2 81 264 3.0E-13
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 706 935 3.0E-13
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 704 932 3.0E-13
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 81 264 3.0E-13
sp|Q3Z3Q4|MACB_SHISS Macrolide export ATP-binding/permease protein MacB OS=Shigella sonnei (strain Ss046) GN=macB PE=3 SV=1 713 938 3.0E-13
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 84 311 3.0E-13
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 704 907 3.0E-13
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 704 907 3.0E-13
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 704 907 3.0E-13
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 704 907 3.0E-13
sp|Q52666|BZTD_RHOCB Glutamate/glutamine/aspartate/asparagine transport ATP-binding protein BztD OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=bztD PE=3 SV=2 713 902 3.0E-13
sp|Q88RA1|TAUB_PSEPK Taurine import ATP-binding protein TauB OS=Pseudomonas putida (strain KT2440) GN=tauB PE=3 SV=1 80 316 4.0E-13
sp|Q5P4W2|MODC_AROAE Molybdenum import ATP-binding protein ModC OS=Aromatoleum aromaticum (strain EbN1) GN=modC PE=3 SV=1 717 936 4.0E-13
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 707 933 4.0E-13
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 81 264 4.0E-13
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 81 264 4.0E-13
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 81 264 4.0E-13
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 81 264 4.0E-13
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 713 938 4.0E-13
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 713 938 4.0E-13
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 704 902 4.0E-13
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 704 921 4.0E-13
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 713 938 4.0E-13
sp|Q8E9I8|PSTB2_SHEON Phosphate import ATP-binding protein PstB 2 OS=Shewanella oneidensis (strain MR-1) GN=pstB2 PE=3 SV=1 84 264 4.0E-13
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 694 909 4.0E-13
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 706 908 4.0E-13
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 81 283 4.0E-13
sp|Q881C1|MODC_PSESM Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=modC PE=3 SV=1 86 289 4.0E-13
sp|Q6G0L7|PSTB_BARQU Phosphate import ATP-binding protein PstB OS=Bartonella quintana (strain Toulouse) GN=pstB PE=3 SV=1 69 264 4.0E-13
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 81 264 4.0E-13
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 81 264 4.0E-13
sp|Q8ZQE4|MACB_SALTY Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=macB PE=3 SV=1 713 931 4.0E-13
sp|Q88F88|MACB_PSEPK Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas putida (strain KT2440) GN=macB PE=3 SV=1 709 901 4.0E-13
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 709 908 4.0E-13
sp|Q8Z824|MACB_SALTI Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhi GN=macB PE=3 SV=1 713 931 4.0E-13
sp|Q5PGK9|MACB_SALPA Macrolide export ATP-binding/permease protein MacB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=macB PE=3 SV=1 713 931 4.0E-13
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 79 267 4.0E-13
sp|Q57R58|MACB_SALCH Macrolide export ATP-binding/permease protein MacB OS=Salmonella choleraesuis (strain SC-B67) GN=macB PE=3 SV=1 713 931 4.0E-13
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 98 296 5.0E-13
sp|Q7UX73|LOLD1_RHOBA Lipoprotein-releasing system ATP-binding protein LolD 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lolD1 PE=3 SV=1 83 279 5.0E-13
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 724 899 5.0E-13
sp|Q8KZR4|TAUB_PSEPU Taurine import ATP-binding protein TauB OS=Pseudomonas putida GN=tauB PE=3 SV=1 81 316 5.0E-13
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 99 264 5.0E-13
sp|Q8XED0|MACB_ECO57 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O157:H7 GN=macB PE=3 SV=1 713 938 5.0E-13
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 724 887 5.0E-13
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 70 290 5.0E-13
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 82 264 5.0E-13
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 81 296 5.0E-13
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 713 907 5.0E-13
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 713 933 5.0E-13
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 84 296 5.0E-13
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 81 264 5.0E-13
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 706 908 5.0E-13
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 710 930 5.0E-13
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 714 933 5.0E-13
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 714 934 5.0E-13
sp|Q2LVL0|MSBA_SYNAS Lipid A export ATP-binding/permease protein MsbA OS=Syntrophus aciditrophicus (strain SB) GN=msbA PE=3 SV=1 63 296 5.0E-13
sp|Q6G4T6|PSTB_BARHE Phosphate import ATP-binding protein PstB OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=pstB PE=3 SV=1 69 264 5.0E-13
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 714 908 5.0E-13
sp|P75957|LOLD_ECOLI Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain K12) GN=lolD PE=1 SV=2 81 264 5.0E-13
sp|Q0B5V4|ARAG2_BURCM Arabinose import ATP-binding protein AraG 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=araG2 PE=3 SV=1 714 926 5.0E-13
sp|P63368|PSTB1_STRA5 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pstB1 PE=3 SV=1 710 939 6.0E-13
sp|P63367|PSTB1_STRA3 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pstB1 PE=3 SV=1 710 939 6.0E-13
sp|Q3K199|PSTB1_STRA1 Phosphate import ATP-binding protein PstB 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pstB1 PE=3 SV=2 710 939 6.0E-13
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 84 304 6.0E-13
sp|Q9JVR5|MACB_NEIMA Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=macB PE=3 SV=1 83 266 6.0E-13
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 710 904 6.0E-13
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 709 908 6.0E-13
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 709 908 6.0E-13
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 81 296 6.0E-13
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 714 933 6.0E-13
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 704 901 6.0E-13
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 87 290 6.0E-13
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 704 932 6.0E-13
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 79 283 6.0E-13
sp|P45861|YWJA_BACSU Uncharacterized ABC transporter ATP-binding protein YwjA OS=Bacillus subtilis (strain 168) GN=ywjA PE=3 SV=1 79 265 7.0E-13
sp|Q98DW6|TAUB_RHILO Taurine import ATP-binding protein TauB OS=Rhizobium loti (strain MAFF303099) GN=tauB PE=3 SV=1 82 283 7.0E-13
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 79 283 7.0E-13
sp|Q74LQ3|PHNC_LACJO Phosphonates import ATP-binding protein PhnC OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=phnC PE=3 SV=2 714 927 7.0E-13
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 712 983 7.0E-13
sp|Q48KB2|MACB_PSE14 Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=macB PE=3 SV=1 67 346 7.0E-13
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 83 284 7.0E-13
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 71 264 7.0E-13
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 79 266 7.0E-13
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 64 296 7.0E-13
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 83 266 7.0E-13
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 704 933 8.0E-13
sp|A0KGB3|MACB1_AERHH Macrolide export ATP-binding/permease protein MacB 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB1 PE=3 SV=1 81 264 8.0E-13
sp|Q49588|PSTB_MYCIT Phosphate import ATP-binding protein PstB OS=Mycobacterium intracellulare GN=pstB PE=3 SV=1 83 264 8.0E-13
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 78 281 8.0E-13
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 81 283 8.0E-13
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 704 902 8.0E-13
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 84 290 9.0E-13
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 713 932 9.0E-13
sp|Q6LV32|THIQ_PHOPR Thiamine import ATP-binding protein ThiQ OS=Photobacterium profundum GN=thiQ PE=3 SV=2 724 934 9.0E-13
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 704 901 9.0E-13
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 83 266 9.0E-13
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 80 264 9.0E-13
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 704 932 9.0E-13
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 717 922 1.0E-12
sp|Q9I190|MACB_PSEAE Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=macB PE=3 SV=1 705 901 1.0E-12
sp|Q02MI4|MACB_PSEAB Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=macB PE=3 SV=1 705 901 1.0E-12
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 709 901 1.0E-12
sp|O31711|YKNY_BACSU Uncharacterized ABC transporter ATP-binding protein YknY OS=Bacillus subtilis (strain 168) GN=yknY PE=1 SV=1 79 292 1.0E-12
sp|Q32DZ9|MACB_SHIDS Macrolide export ATP-binding/permease protein MacB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=macB PE=3 SV=1 79 267 1.0E-12
sp|Q82VK1|MACB_NITEU Macrolide export ATP-binding/permease protein MacB OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=macB PE=3 SV=1 705 901 1.0E-12
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 83 266 1.0E-12
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 714 933 1.0E-12
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 704 932 1.0E-12
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 704 932 1.0E-12
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 704 932 1.0E-12
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 713 935 1.0E-12
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 83 264 1.0E-12
sp|Q2KVS6|MACB_BORA1 Macrolide export ATP-binding/permease protein MacB OS=Bordetella avium (strain 197N) GN=macB PE=3 SV=2 713 901 1.0E-12
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 714 920 1.0E-12
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 704 902 1.0E-12
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 86 289 1.0E-12
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 704 942 1.0E-12
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 712 933 1.0E-12
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 713 932 1.0E-12
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 713 932 1.0E-12
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 713 932 1.0E-12
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 713 932 1.0E-12
sp|Q1MA70|MODC_RHIL3 Molybdenum import ATP-binding protein ModC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=modC PE=3 SV=1 96 296 1.0E-12
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 709 951 1.0E-12
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 710 935 1.0E-12
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 704 901 1.0E-12
sp|Q4ZSS5|MODC_PSEU2 Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=modC PE=3 SV=1 86 289 1.0E-12
sp|Q9KN92|PSTB2_VIBCH Phosphate import ATP-binding protein PstB 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pstB2 PE=3 SV=1 84 264 1.0E-12
sp|Q2RPB4|MACB_RHORT Macrolide export ATP-binding/permease protein MacB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=macB PE=3 SV=1 63 290 1.0E-12
sp|Q4FQD1|PSTB_PSYA2 Phosphate import ATP-binding protein PstB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=pstB PE=3 SV=2 714 939 1.0E-12
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 711 924 1.0E-12
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 709 902 1.0E-12
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 713 900 1.0E-12
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 712 933 1.0E-12
sp|Q1Q8K4|PSTB_PSYCK Phosphate import ATP-binding protein PstB OS=Psychrobacter cryohalolentis (strain K5) GN=pstB PE=3 SV=2 714 939 1.0E-12
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 729 901 1.0E-12
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 702 908 1.0E-12
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 714 939 1.0E-12
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 712 933 1.0E-12
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 709 933 1.0E-12
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 714 927 1.0E-12
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 87 290 1.0E-12
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 967 1279 2.0E-12
sp|D4AYW0|ABCG1_ARTBC ABC transporter G family member ARB_01379 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01379 PE=1 SV=1 376 590 2.0E-12
sp|Q2W1R8|MODC_MAGSA Molybdenum import ATP-binding protein ModC OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=modC PE=3 SV=1 726 934 2.0E-12
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 706 901 2.0E-12
sp|P44986|THIQ_HAEIN Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=thiQ PE=1 SV=2 98 283 2.0E-12
sp|Q21GS5|MODC_SACD2 Molybdenum import ATP-binding protein ModC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=modC PE=3 SV=1 726 920 2.0E-12
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 81 265 2.0E-12
sp|Q4K9A4|MACB2_PSEF5 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB2 PE=3 SV=1 700 901 2.0E-12
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 710 901 2.0E-12
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 710 901 2.0E-12
sp|Q2JLH7|PHNC2_SYNJB Phosphonates import ATP-binding protein PhnC 2 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=phnC2 PE=3 SV=1 84 289 2.0E-12
sp|Q04EY4|ECFA3_OENOB Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA3 PE=3 SV=1 714 988 2.0E-12
sp|Q9K619|BCEA_BACHD Bacitracin export ATP-binding protein BceA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=bceA PE=3 SV=1 705 901 2.0E-12
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 724 920 2.0E-12
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 98 290 2.0E-12
sp|Q81C68|SSUB_BACCR Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ssuB PE=3 SV=1 713 922 2.0E-12
sp|Q46ZA5|PSTB_CUPPJ Phosphate import ATP-binding protein PstB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pstB PE=3 SV=1 714 939 2.0E-12
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 714 929 2.0E-12
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 712 933 2.0E-12
sp|Q2SJB5|MODC_HAHCH Molybdenum import ATP-binding protein ModC OS=Hahella chejuensis (strain KCTC 2396) GN=modC PE=3 SV=1 92 283 2.0E-12
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 710 934 2.0E-12
sp|Q1LLB5|PSTB_CUPMC Phosphate import ATP-binding protein PstB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pstB PE=3 SV=1 714 939 2.0E-12
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 709 908 2.0E-12
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 712 902 2.0E-12
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 87 290 2.0E-12
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 87 290 2.0E-12
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 87 290 2.0E-12
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 87 290 2.0E-12
sp|Q1GAD3|PSTB_LACDA Phosphate import ATP-binding protein PstB OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pstB PE=3 SV=1 84 265 2.0E-12
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 708 955 2.0E-12
sp|Q8UII7|UGPC1_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC1 PE=3 SV=1 84 283 2.0E-12
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 80 264 2.0E-12
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 717 946 2.0E-12
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 82 264 2.0E-12
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 704 932 2.0E-12
sp|P16677|PHNC_ECOLI Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain K12) GN=phnC PE=3 SV=2 704 930 2.0E-12
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 713 938 2.0E-12
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 82 264 2.0E-12
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 84 265 2.0E-12
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 69 296 2.0E-12
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 87 290 2.0E-12
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 81 296 2.0E-12
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 81 290 2.0E-12
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 82 283 3.0E-12
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 706 901 3.0E-12
sp|Q48J29|MODC_PSE14 Molybdenum import ATP-binding protein ModC OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=modC PE=3 SV=1 718 936 3.0E-12
sp|A0B212|MACB_BURCH Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain HI2424) GN=macB PE=3 SV=1 713 901 3.0E-12
sp|Q1BPZ6|MACB_BURCA Macrolide export ATP-binding/permease protein MacB OS=Burkholderia cenocepacia (strain AU 1054) GN=macB PE=3 SV=2 713 901 3.0E-12
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 724 895 3.0E-12
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 724 887 3.0E-12
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 729 901 3.0E-12
sp|P75831|MACB_ECOLI Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain K12) GN=macB PE=1 SV=1 79 267 3.0E-12
sp|Q3Z3Q4|MACB_SHISS Macrolide export ATP-binding/permease protein MacB OS=Shigella sonnei (strain Ss046) GN=macB PE=3 SV=1 78 267 3.0E-12
sp|Q1RE44|MACB_ECOUT Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli (strain UTI89 / UPEC) GN=macB PE=3 SV=1 79 267 3.0E-12
sp|A1A9B7|MACB1_ECOK1 Macrolide export ATP-binding/permease protein MacB 1 OS=Escherichia coli O1:K1 / APEC GN=macB1 PE=3 SV=1 79 267 3.0E-12
sp|Q0TJH0|MACB_ECOL5 Macrolide export ATP-binding/permease protein MacB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=macB PE=3 SV=1 79 267 3.0E-12
sp|Q88F88|MACB_PSEPK Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas putida (strain KT2440) GN=macB PE=3 SV=1 78 264 3.0E-12
sp|Q608V9|MODC_METCA Molybdenum import ATP-binding protein ModC OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=modC PE=3 SV=1 717 937 3.0E-12
sp|Q9CM47|MACB_PASMU Macrolide export ATP-binding/permease protein MacB OS=Pasteurella multocida (strain Pm70) GN=macB PE=3 SV=1 78 264 4.0E-12
sp|Q8DU24|PSTB1_STRMU Phosphate import ATP-binding protein PstB 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pstB1 PE=3 SV=1 710 899 4.0E-12
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 91 284 4.0E-12
sp|Q323M3|MACB_SHIBS Macrolide export ATP-binding/permease protein MacB OS=Shigella boydii serotype 4 (strain Sb227) GN=macB PE=3 SV=1 79 267 4.0E-12
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 82 283 5.0E-12
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 99 301 5.0E-12
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 710 901 5.0E-12
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 706 901 6.0E-12
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 706 901 6.0E-12
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 706 901 6.0E-12
sp|Q4QLQ1|THIQ_HAEI8 Thiamine import ATP-binding protein ThiQ OS=Haemophilus influenzae (strain 86-028NP) GN=thiQ PE=3 SV=2 98 283 6.0E-12
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 710 901 6.0E-12
sp|A0KGB3|MACB1_AERHH Macrolide export ATP-binding/permease protein MacB 1 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB1 PE=3 SV=1 710 901 6.0E-12
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 84 264 6.0E-12
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 90 264 6.0E-12
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 82 283 7.0E-12
sp|Q7NUJ3|MACB_CHRVO Macrolide export ATP-binding/permease protein MacB OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=macB PE=3 SV=1 712 901 7.0E-12
sp|P75612|Y081_MYCPN Putative ABC transporter ATP-binding protein MG065 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_081 PE=3 SV=1 80 264 7.0E-12
sp|Q8RD07|Y246_CALS4 Putative ABC transporter ATP-binding protein TTE0246 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=TTE0246 PE=3 SV=1 78 285 7.0E-12
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 82 283 8.0E-12
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 82 283 8.0E-12
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 706 901 8.0E-12
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 717 920 8.0E-12
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 82 283 9.0E-12
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 82 283 9.0E-12
sp|Q399M3|MACB_BURL3 Macrolide export ATP-binding/permease protein MacB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=macB PE=3 SV=1 713 901 9.0E-12
sp|Q3SJC6|MODC_THIDA Molybdenum import ATP-binding protein ModC OS=Thiobacillus denitrificans (strain ATCC 25259) GN=modC PE=3 SV=1 717 937 9.0E-12
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 82 283 1.0E-11
sp|O34677|GLNQ_BACSU Glutamine transport ATP-binding protein GlnQ OS=Bacillus subtilis (strain 168) GN=glnQ PE=2 SV=1 83 265 1.0E-11
sp|Q58206|Y796_METJA Uncharacterized ABC transporter ATP-binding protein MJ0796 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0796 PE=1 SV=1 84 264 1.0E-11
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 705 901 1.0E-11
sp|Q89EW7|MODC2_BRADU Molybdenum import ATP-binding protein ModC 2 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=modC2 PE=3 SV=1 720 928 2.0E-11
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 82 290 2.0E-11
sp|O34392|YTRE_BACSU ABC transporter ATP-binding protein YtrE OS=Bacillus subtilis (strain 168) GN=ytrE PE=2 SV=1 713 901 2.0E-11
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 96 321 2.0E-11
sp|Q57R58|MACB_SALCH Macrolide export ATP-binding/permease protein MacB OS=Salmonella choleraesuis (strain SC-B67) GN=macB PE=3 SV=1 79 266 2.0E-11
sp|Q9NRK6|ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens GN=ABCB10 PE=1 SV=2 81 265 2.0E-11
sp|Q4KC87|FBPC_PSEF5 Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fbpC PE=3 SV=1 81 290 3.0E-11
sp|Q6D7D0|MODC_PECAS Molybdenum import ATP-binding protein ModC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=modC PE=3 SV=1 717 920 3.0E-11
sp|Q2IXX0|MACB_RHOP2 Macrolide export ATP-binding/permease protein MacB OS=Rhodopseudomonas palustris (strain HaA2) GN=macB PE=3 SV=1 714 903 3.0E-11
sp|Q6FYL0|MACB_BARQU Macrolide export ATP-binding/permease protein MacB OS=Bartonella quintana (strain Toulouse) GN=macB PE=3 SV=1 83 264 3.0E-11
sp|Q4FU75|MACB_PSYA2 Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=macB PE=3 SV=1 713 901 3.0E-11
sp|Q6NA00|PHNC2_RHOPA Phosphonates import ATP-binding protein PhnC 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=phnC2 PE=3 SV=1 711 929 3.0E-11
sp|Q1QDA8|MACB_PSYCK Macrolide export ATP-binding/permease protein MacB OS=Psychrobacter cryohalolentis (strain K5) GN=macB PE=3 SV=1 713 901 3.0E-11
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 79 281 3.0E-11
sp|Q9K0N7|MACB_NEIMB Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup B (strain MC58) GN=macB PE=3 SV=1 710 901 3.0E-11
sp|Q54BU4|ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum GN=abcB1 PE=3 SV=1 80 296 3.0E-11
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 79 264 4.0E-11
sp|Q881C1|MODC_PSESM Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=modC PE=3 SV=1 718 936 4.0E-11
sp|Q5MK06|MACB_NEIGO Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae GN=macB PE=1 SV=1 710 901 4.0E-11
sp|Q5F6V6|MACB_NEIG1 Macrolide export ATP-binding/permease protein MacB OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=macB PE=3 SV=1 710 901 4.0E-11
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 729 901 4.0E-11
sp|Q2RWI9|MODC_RHORT Molybdenum import ATP-binding protein ModC OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=modC PE=3 SV=1 717 933 5.0E-11
sp|P97027|SSUB_BACSU Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus subtilis (strain 168) GN=ssuB PE=1 SV=4 83 281 5.0E-11
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 79 264 5.0E-11
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 82 290 5.0E-11
sp|Q2EHL8|MACB_AGGAC Macrolide export ATP-binding/permease protein MacB OS=Aggregatibacter actinomycetemcomitans GN=macB PE=1 SV=2 83 264 5.0E-11
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 624 901 5.0E-11
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1029 1297 6.0E-11
sp|Q98KI3|MODC_RHILO Molybdenum import ATP-binding protein ModC OS=Rhizobium loti (strain MAFF303099) GN=modC PE=3 SV=1 723 936 6.0E-11
sp|Q92NU9|MACB_RHIME Macrolide export ATP-binding/permease protein MacB OS=Rhizobium meliloti (strain 1021) GN=macB PE=3 SV=1 713 901 6.0E-11
sp|P27675|GLNQ_GEOSE Glutamine transport ATP-binding protein GlnQ OS=Geobacillus stearothermophilus GN=glnQ PE=2 SV=1 83 265 6.0E-11
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 82 283 7.0E-11
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 91 264 7.0E-11
sp|Q8ZQE4|MACB_SALTY Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=macB PE=3 SV=1 79 266 7.0E-11
sp|Q8Z824|MACB_SALTI Macrolide export ATP-binding/permease protein MacB OS=Salmonella typhi GN=macB PE=3 SV=1 79 266 7.0E-11
sp|Q5PGK9|MACB_SALPA Macrolide export ATP-binding/permease protein MacB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=macB PE=3 SV=1 79 266 7.0E-11
sp|Q3ATR5|MACB_CHLCH Macrolide export ATP-binding/permease protein MacB OS=Chlorobium chlorochromatii (strain CaD3) GN=macB PE=3 SV=1 714 902 8.0E-11
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 673 901 8.0E-11
sp|Q2K2X0|MODC_RHIEC Molybdenum import ATP-binding protein ModC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=modC PE=3 SV=1 717 933 8.0E-11
sp|Q6AMR9|LOLD_DESPS Lipoprotein-releasing system ATP-binding protein LolD OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=lolD PE=3 SV=1 713 899 8.0E-11
sp|P96117|TROB_TREPA Zinc transport system ATP-binding protein TroB OS=Treponema pallidum (strain Nichols) GN=troB PE=3 SV=1 82 281 8.0E-11
sp|O27739|ECFA_METTH Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ecfA PE=3 SV=1 76 264 8.0E-11
sp|Q9WYI7|Y352_THEMA Uncharacterized ABC transporter ATP-binding protein TM_0352 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0352 PE=3 SV=1 84 264 9.0E-11
sp|Q1I7I9|MACB2_PSEE4 Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas entomophila (strain L48) GN=macB2 PE=3 SV=1 709 901 1.0E-10
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 714 973 1.0E-10
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 98 264 1.0E-10
sp|Q9RYZ3|PSTB_DEIRA Phosphate import ATP-binding protein PstB OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pstB PE=3 SV=1 711 939 1.0E-10
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 714 973 1.0E-10
sp|P37774|YECC_ECOLI L-cystine transport system ATP-binding protein YecC OS=Escherichia coli (strain K12) GN=yecC PE=3 SV=2 83 290 1.0E-10
sp|A1K323|MACB_AZOSB Macrolide export ATP-binding/permease protein MacB OS=Azoarcus sp. (strain BH72) GN=macB PE=3 SV=1 713 901 1.0E-10
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 710 935 1.0E-10
sp|Q9JVR5|MACB_NEIMA Macrolide export ATP-binding/permease protein MacB OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=macB PE=3 SV=1 710 901 1.0E-10
sp|Q8RLB6|SSUB_DELAC Aliphatic sulfonates import ATP-binding protein SsuB OS=Delftia acidovorans GN=ssuB PE=3 SV=1 711 922 1.0E-10
sp|Q49588|PSTB_MYCIT Phosphate import ATP-binding protein PstB OS=Mycobacterium intracellulare GN=pstB PE=3 SV=1 711 949 1.0E-10
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 83 306 1.0E-10
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 94 288 1.0E-10
sp|P07821|FHUC_ECOLI Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Escherichia coli (strain K12) GN=fhuC PE=1 SV=3 83 264 2.0E-10
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 717 927 2.0E-10
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 84 309 2.0E-10
sp|Q48C94|TAUB_PSE14 Taurine import ATP-binding protein TauB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tauB PE=3 SV=1 80 281 2.0E-10
sp|Q87UH7|TAUB_PSESM Taurine import ATP-binding protein TauB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tauB PE=3 SV=1 80 281 2.0E-10
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 91 264 2.0E-10
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 672 951 2.0E-10
sp|O28882|LIVF_ARCFU Probable branched-chain amino acid transport ATP-binding protein LivF OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=livF PE=3 SV=1 83 296 2.0E-10
sp|Q4ZSS5|MODC_PSEU2 Molybdenum import ATP-binding protein ModC OS=Pseudomonas syringae pv. syringae (strain B728a) GN=modC PE=3 SV=1 718 936 2.0E-10
sp|Q2RPB4|MACB_RHORT Macrolide export ATP-binding/permease protein MacB OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=macB PE=3 SV=1 714 901 2.0E-10
sp|Q9LVM1|AB25B_ARATH ABC transporter B family member 25, mitochondrial OS=Arabidopsis thaliana GN=ABCB25 PE=1 SV=1 83 289 2.0E-10
sp|P48243|GLUA_CORGL Glutamate transport ATP-binding protein GluA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=gluA PE=3 SV=2 84 265 3.0E-10
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 709 904 3.0E-10
sp|A0KMJ3|MACB2_AERHH Macrolide export ATP-binding/permease protein MacB 2 OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=macB2 PE=3 SV=1 83 283 3.0E-10
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 624 901 3.0E-10
sp|Q0T7M2|TAUB_SHIF8 Taurine import ATP-binding protein TauB OS=Shigella flexneri serotype 5b (strain 8401) GN=tauB PE=3 SV=1 81 283 4.0E-10
sp|Q4KES7|MACB1_PSEF5 Macrolide export ATP-binding/permease protein MacB 1 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=macB1 PE=3 SV=1 714 904 4.0E-10
sp|P47311|Y065_MYCGE Putative ABC transporter ATP-binding protein MG065 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG065 PE=3 SV=1 713 909 4.0E-10
sp|Q3KJQ7|TAUB_PSEPF Taurine import ATP-binding protein TauB OS=Pseudomonas fluorescens (strain Pf0-1) GN=tauB PE=3 SV=1 82 281 4.0E-10
sp|Q8RQL7|GLUA_COREF Glutamate transport ATP-binding protein GluA OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=gluA PE=3 SV=1 68 265 5.0E-10
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 73 331 5.0E-10
sp|Q2VZJ1|CCMA_MAGSA Cytochrome c biogenesis ATP-binding export protein CcmA OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=ccmA PE=3 SV=1 99 273 5.0E-10
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 84 290 5.0E-10
sp|Q1MA70|MODC_RHIL3 Molybdenum import ATP-binding protein ModC OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=modC PE=3 SV=1 726 933 5.0E-10
sp|Q66D71|MODC_YERPS Molybdenum import ATP-binding protein ModC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=modC PE=3 SV=1 717 920 6.0E-10
sp|Q1CFP9|MODC_YERPN Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=modC PE=3 SV=1 717 920 6.0E-10
sp|Q8ZGX6|MODC_YERPE Molybdenum import ATP-binding protein ModC OS=Yersinia pestis GN=modC PE=3 SV=1 717 920 6.0E-10
sp|Q1C951|MODC_YERPA Molybdenum import ATP-binding protein ModC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=modC PE=3 SV=1 717 920 6.0E-10
sp|Q3KE48|MACB2_PSEPF Macrolide export ATP-binding/permease protein MacB 2 OS=Pseudomonas fluorescens (strain Pf0-1) GN=macB2 PE=3 SV=1 714 904 6.0E-10
sp|P23886|CYDC_ECOLI ATP-binding/permease protein CydC OS=Escherichia coli (strain K12) GN=cydC PE=3 SV=2 634 920 6.0E-10
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 91 264 7.0E-10
sp|P49938|FHUC_BACSU Iron(3+)-hydroxamate import ATP-binding protein FhuC OS=Bacillus subtilis (strain 168) GN=fhuC PE=3 SV=1 83 290 7.0E-10
sp|Q04FM1|ECFA2_OENOB Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=ecfA2 PE=3 SV=1 84 283 7.0E-10
sp|Q83HT1|PSTB_TROW8 Phosphate import ATP-binding protein PstB OS=Tropheryma whipplei (strain TW08/27) GN=pstB PE=3 SV=1 84 265 7.0E-10
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 68 265 8.0E-10
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 83 290 8.0E-10
sp|O34338|MNTB_BACSU Manganese transport system ATP-binding protein MntB OS=Bacillus subtilis (strain 168) GN=mntB PE=3 SV=1 82 280 9.0E-10
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 84 289 1.0E-09
sp|Q9X1Z1|ECFA1_THEMA Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ecfA1 PE=1 SV=1 83 290 1.0E-09
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 84 264 1.0E-09
sp|Q737I0|Y2668_BACC1 Putative ABC transporter ATP-binding protein BCE_2668 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_2668 PE=3 SV=1 82 343 1.0E-09
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 707 901 1.0E-09
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 65 265 1.0E-09
sp|Q3Z300|LOLD_SHISS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella sonnei (strain Ss046) GN=lolD PE=3 SV=2 713 901 1.0E-09
sp|Q1RD37|LOLD_ECOUT Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain UTI89 / UPEC) GN=lolD PE=3 SV=1 713 901 1.0E-09
sp|Q8FIM7|LOLD_ECOL6 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lolD PE=3 SV=1 713 901 1.0E-09
sp|Q0TIV6|LOLD_ECOL5 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lolD PE=3 SV=2 713 901 1.0E-09
sp|Q32EX7|LOLD_SHIDS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lolD PE=3 SV=2 713 901 1.0E-09
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 83 264 1.0E-09
sp|Q46ZU5|SSUB_CUPPJ Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ssuB PE=3 SV=1 706 878 1.0E-09
sp|P0AAF9|ARTP_SHIFL Arginine transport ATP-binding protein ArtP OS=Shigella flexneri GN=artP PE=3 SV=1 84 265 2.0E-09
sp|P0AAF6|ARTP_ECOLI Arginine transport ATP-binding protein ArtP OS=Escherichia coli (strain K12) GN=artP PE=1 SV=1 84 265 2.0E-09
sp|P0AAF7|ARTP_ECOL6 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=artP PE=3 SV=1 84 265 2.0E-09
sp|P0AAF8|ARTP_ECO57 Arginine transport ATP-binding protein ArtP OS=Escherichia coli O157:H7 GN=artP PE=3 SV=1 84 265 2.0E-09
sp|Q3KC21|MODC_PSEPF Molybdenum import ATP-binding protein ModC OS=Pseudomonas fluorescens (strain Pf0-1) GN=modC PE=3 SV=1 717 936 2.0E-09
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 84 290 2.0E-09
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 81 264 2.0E-09
sp|Q8U648|SSUB2_AGRFC Aliphatic sulfonates import ATP-binding protein SsuB 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ssuB2 PE=3 SV=2 713 925 2.0E-09
sp|Q8EAN3|MODC_SHEON Molybdenum import ATP-binding protein ModC OS=Shewanella oneidensis (strain MR-1) GN=modC PE=3 SV=1 717 949 2.0E-09
sp|P75957|LOLD_ECOLI Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli (strain K12) GN=lolD PE=1 SV=2 713 901 2.0E-09
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 717 968 2.0E-09
sp|Q5FA19|FBPC_NEIG1 Fe(3+) ions import ATP-binding protein FbpC OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=fbpC PE=1 SV=1 704 901 2.0E-09
sp|Q7CN92|POTA_STRP8 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=potA PE=3 SV=1 81 290 2.0E-09
sp|Q99ZS8|POTA_STRP1 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M1 GN=potA PE=3 SV=1 81 290 2.0E-09
sp|Q6W2B1|TAUB_RHISN Taurine import ATP-binding protein TauB OS=Rhizobium sp. (strain NGR234) GN=tauB PE=3 SV=2 83 281 3.0E-09
sp|Q5HQ70|POTA_STAEQ Spermidine/putrescine import ATP-binding protein PotA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=potA PE=3 SV=1 68 283 3.0E-09
sp|Q2NHA1|ECFA_METST Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=ecfA PE=3 SV=1 79 264 3.0E-09
sp|Q1J6Q6|POTA_STRPF Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=potA PE=3 SV=1 81 290 3.0E-09
sp|Q1JGY7|POTA_STRPD Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=potA PE=3 SV=1 81 290 3.0E-09
sp|Q1JLT7|POTA_STRPC Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=potA PE=3 SV=1 81 290 3.0E-09
sp|Q1JBV6|POTA_STRPB Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=potA PE=3 SV=1 81 290 3.0E-09
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 711 934 3.0E-09
sp|Q882S0|PHNC2_PSESM Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=phnC2 PE=3 SV=1 76 265 3.0E-09
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 95 294 4.0E-09
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 699 901 4.0E-09
sp|Q0SWH9|ECFA2_CLOPS Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Clostridium perfringens (strain SM101 / Type A) GN=ecfA2 PE=3 SV=1 78 290 4.0E-09
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 672 901 4.0E-09
sp|P0CZ35|POTA_STRPQ Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=potA PE=3 SV=1 81 290 4.0E-09
sp|Q48TP4|POTA_STRPM Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=potA PE=3 SV=1 81 290 4.0E-09
sp|Q5XCA4|POTA_STRP6 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=potA PE=3 SV=1 81 290 4.0E-09
sp|P0CZ34|POTA_STRP3 Spermidine/putrescine import ATP-binding protein PotA OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=potA PE=3 SV=1 81 290 4.0E-09
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 90 294 4.0E-09
sp|Q67JX4|ECFA2_SYMTH Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ecfA2 PE=3 SV=1 84 283 5.0E-09
sp|Q7VKP7|MODC_HAEDU Molybdenum import ATP-binding protein ModC OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=modC PE=3 SV=1 717 925 5.0E-09
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 717 968 5.0E-09
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 717 968 5.0E-09
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 717 968 5.0E-09
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 717 968 5.0E-09
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 717 968 5.0E-09
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 717 968 5.0E-09
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 80 290 6.0E-09
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 729 901 6.0E-09
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 82 348 6.0E-09
sp|Q31ZH4|LOLD_SHIBS Lipoprotein-releasing system ATP-binding protein LolD OS=Shigella boydii serotype 4 (strain Sb227) GN=lolD PE=3 SV=2 713 901 7.0E-09
sp|Q65M64|SSUB_BACLD Aliphatic sulfonates import ATP-binding protein SsuB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=ssuB PE=3 SV=1 81 298 7.0E-09
sp|Q39CJ6|TAUB_BURL3 Taurine import ATP-binding protein TauB OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tauB PE=3 SV=1 80 283 7.0E-09
sp|A0KAV6|TAUB_BURCH Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain HI2424) GN=tauB PE=3 SV=1 80 283 7.0E-09
sp|Q1BT84|TAUB_BURCA Taurine import ATP-binding protein TauB OS=Burkholderia cenocepacia (strain AU 1054) GN=tauB PE=3 SV=1 80 283 7.0E-09
sp|Q6AJW3|MSBA_DESPS Lipid A export ATP-binding/permease protein MsbA OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=msbA PE=3 SV=1 711 933 7.0E-09
sp|Q03AH0|POTA_LACC3 Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus casei (strain ATCC 334) GN=potA PE=3 SV=1 81 290 8.0E-09
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 84 290 8.0E-09
sp|Q0HFA0|MODC_SHESM Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-4) GN=modC PE=3 SV=1 717 928 9.0E-09
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 718 901 9.0E-09
sp|Q3A558|LOLD_PELCD Lipoprotein-releasing system ATP-binding protein LolD OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lolD PE=3 SV=1 78 267 9.0E-09
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 1086 1272 1.0E-08
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 61 264 1.0E-08
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 80 290 1.0E-08
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 717 901 1.0E-08
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 717 901 1.0E-08
sp|Q47CB7|MODC_DECAR Molybdenum import ATP-binding protein ModC OS=Dechloromonas aromatica (strain RCB) GN=modC PE=3 SV=1 707 975 1.0E-08
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 77 264 1.0E-08
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 79 284 1.0E-08
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 704 927 1.0E-08
sp|Q8X8E3|LOLD_ECO57 Lipoprotein-releasing system ATP-binding protein LolD OS=Escherichia coli O157:H7 GN=lolD PE=3 SV=2 713 901 1.0E-08
sp|Q48KB2|MACB_PSE14 Macrolide export ATP-binding/permease protein MacB OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=macB PE=3 SV=1 700 901 1.0E-08
sp|Q6F9P2|METN2_ACIAD Methionine import ATP-binding protein MetN 2 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metN2 PE=3 SV=1 80 265 1.0E-08
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 726 901 1.0E-08
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 711 934 1.0E-08
sp|Q664P8|TAUB_YERPS Taurine import ATP-binding protein TauB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tauB PE=3 SV=1 82 283 2.0E-08
sp|Q1CCR9|TAUB_YERPN Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tauB PE=3 SV=1 82 283 2.0E-08
sp|Q8ZJD0|TAUB_YERPE Taurine import ATP-binding protein TauB OS=Yersinia pestis GN=tauB PE=3 SV=1 82 283 2.0E-08
sp|Q1C2S1|TAUB_YERPA Taurine import ATP-binding protein TauB OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tauB PE=3 SV=1 82 283 2.0E-08
sp|Q0TUN8|ECFA3_CLOP1 Energy-coupling factor transporter ATP-binding protein EcfA3 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ecfA3 PE=1 SV=1 78 290 2.0E-08
sp|Q0HYN8|MODC_SHESR Molybdenum import ATP-binding protein ModC OS=Shewanella sp. (strain MR-7) GN=modC PE=3 SV=1 717 928 2.0E-08
sp|Q5E0T4|MODC_VIBF1 Molybdenum import ATP-binding protein ModC OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=modC PE=3 SV=1 713 920 2.0E-08
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 718 901 2.0E-08
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 709 960 2.0E-08
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 78 290 2.0E-08
sp|O06980|YVCR_BACSU Uncharacterized ABC transporter ATP-binding protein YvcR OS=Bacillus subtilis (strain 168) GN=yvcR PE=3 SV=1 99 264 2.0E-08
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 729 901 2.0E-08
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 143 296 2.0E-08
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 143 296 2.0E-08
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 143 296 2.0E-08
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 143 296 2.0E-08
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 98 265 2.0E-08
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 98 265 2.0E-08
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 98 265 2.0E-08
sp|Q6LX68|ECFA_METMP Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanococcus maripaludis (strain S2 / LL) GN=ecfA PE=3 SV=1 208 264 2.0E-08
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 98 265 2.0E-08
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 83 290 3.0E-08
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 729 901 3.0E-08
sp|Q9FNU2|AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica GN=OsABCB25 PE=2 SV=1 709 902 3.0E-08
sp|Q0K9I2|SSUB_CUPNH Aliphatic sulfonates import ATP-binding protein SsuB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=ssuB PE=3 SV=1 706 878 3.0E-08
sp|Q8XNY7|Y195_CLOPE Putative ABC transporter ATP-binding protein CPE0195 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE0195 PE=3 SV=1 78 290 3.0E-08
sp|Q0K2U3|TAUB_CUPNH Taurine import ATP-binding protein TauB OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tauB PE=3 SV=1 84 281 3.0E-08
sp|Q02QM1|PHNC1_PSEAB Phosphonates import ATP-binding protein PhnC 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=phnC1 PE=3 SV=1 84 265 3.0E-08
sp|Q9HYL7|PHNC2_PSEAE Phosphonates import ATP-binding protein PhnC 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=phnC2 PE=3 SV=1 84 265 3.0E-08
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 706 876 3.0E-08
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 729 901 4.0E-08
sp|Q9GTN7|TAGA_DICDI Serine protease/ABC transporter B family protein tagA OS=Dictyostelium discoideum GN=tagA PE=1 SV=2 83 265 4.0E-08
sp|Q6N0P7|MODC_RHOPA Molybdenum import ATP-binding protein ModC OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=modC PE=3 SV=1 717 932 4.0E-08
sp|Q9KLL9|MODC_VIBCH Molybdenum import ATP-binding protein ModC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=modC PE=3 SV=1 717 928 4.0E-08
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 91 264 5.0E-08
sp|Q668Q3|FBPC_YERPS Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fbpC PE=3 SV=1 83 289 5.0E-08
sp|Q1CJS9|FBPC_YERPN Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fbpC PE=3 SV=1 83 289 5.0E-08
sp|Q8ZCM2|FBPC_YERPE Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis GN=fbpC PE=3 SV=1 83 289 5.0E-08
sp|Q1C607|FBPC_YERPA Fe(3+) ions import ATP-binding protein FbpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fbpC PE=3 SV=1 83 289 5.0E-08
sp|Q9KN92|PSTB2_VIBCH Phosphate import ATP-binding protein PstB 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pstB2 PE=3 SV=1 714 938 5.0E-08
sp|P96605|YDBJ_BACSU Uncharacterized ABC transporter ATP-binding protein YdbJ OS=Bacillus subtilis (strain 168) GN=ydbJ PE=3 SV=1 83 283 6.0E-08
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 816 932 7.0E-08
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 724 927 7.0E-08
sp|P39456|TCYC_BACSU L-cystine import ATP-binding protein TcyC OS=Bacillus subtilis (strain 168) GN=tcyC PE=1 SV=4 83 285 7.0E-08
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 81 301 8.0E-08
sp|Q50801|Y583_METTM Putative ABC transporter ATP-binding protein MTBMA_c05830 OS=Methanothermobacter marburgensis (strain DSM 2133 / 14651 / NBRC 100331 / OCM 82 / Marburg) GN=MTBMA_c05830 PE=3 SV=2 79 264 8.0E-08
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 82 290 8.0E-08
sp|Q1LLB5|PSTB_CUPMC Phosphate import ATP-binding protein PstB OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pstB PE=3 SV=1 84 265 8.0E-08
sp|Q3A6U0|PSTB_PELCD Phosphate import ATP-binding protein PstB OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pstB PE=3 SV=1 714 939 8.0E-08
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 182 264 9.0E-08
sp|O26236|Y133_METTH Putative ABC transporter ATP-binding protein MTH_133 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=MTH_133 PE=3 SV=1 208 296 9.0E-08
sp|Q81PZ8|Y2641_BACAN Putative ABC transporter ATP-binding protein BA_2641/GBAA_2641/BAS2461 OS=Bacillus anthracis GN=BA_2641 PE=3 SV=1 18 283 9.0E-08
sp|Q7NX01|CYSA1_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA1 PE=3 SV=1 84 290 9.0E-08
sp|A1B9Q7|UGPC_PARDP sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Paracoccus denitrificans (strain Pd 1222) GN=ugpC PE=3 SV=1 713 876 1.0E-07
sp|Q9NP78|ABCB9_HUMAN ATP-binding cassette sub-family B member 9 OS=Homo sapiens GN=ABCB9 PE=1 SV=1 709 902 1.0E-07
sp|O34362|YKOD_BACSU Putative HMP/thiamine import ATP-binding protein YkoD OS=Bacillus subtilis (strain 168) GN=ykoD PE=1 SV=2 79 265 1.0E-07
sp|Q9QYJ4|ABCB9_RAT ATP-binding cassette sub-family B member 9 OS=Rattus norvegicus GN=Abcb9 PE=1 SV=1 709 973 1.0E-07
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 709 976 1.0E-07
sp|Q2SJB5|MODC_HAHCH Molybdenum import ATP-binding protein ModC OS=Hahella chejuensis (strain KCTC 2396) GN=modC PE=3 SV=1 722 920 1.0E-07
sp|Q8U4L3|Y068_PYRFU Putative ABC transporter ATP-binding protein PF0068 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0068 PE=3 SV=1 82 289 2.0E-07
sp|Q52815|AAPP_RHIL3 General L-amino acid transport ATP-binding protein AapP OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=aapP PE=3 SV=1 99 265 2.0E-07
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 80 290 2.0E-07
sp|A3PRY1|UGPC_RHOS1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ugpC PE=3 SV=1 713 876 2.0E-07
sp|Q3IX40|UGPC_RHOS4 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ugpC PE=3 SV=1 713 876 2.0E-07
sp|Q57213|Y1474_HAEIN Uncharacterized ABC transporter ATP-binding protein HI_1474 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1474 PE=3 SV=1 710 904 2.0E-07
sp|Q5UW69|PHNC2_HALMA Phosphonates import ATP-binding protein PhnC 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=phnC2 PE=3 SV=1 84 289 2.0E-07
sp|Q5LX21|UGPC_RUEPO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=ugpC PE=3 SV=1 713 876 2.0E-07
sp|Q46ZA5|PSTB_CUPPJ Phosphate import ATP-binding protein PstB OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pstB PE=3 SV=1 84 265 2.0E-07
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 82 343 2.0E-07
sp|Q31DV4|PHNC_THICR Phosphonates import ATP-binding protein PhnC OS=Thiomicrospira crunogena (strain XCL-2) GN=phnC PE=3 SV=1 79 289 2.0E-07
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 96 290 2.0E-07
sp|Q9JJ59|ABCB9_MOUSE ATP-binding cassette sub-family B member 9 OS=Mus musculus GN=Abcb9 PE=2 SV=1 709 955 2.0E-07
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 83 290 3.0E-07
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 96 283 3.0E-07
sp|Q81CT8|Y2655_BACCR Putative ABC transporter ATP-binding protein BC_2655 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=BC_2655 PE=3 SV=2 18 286 3.0E-07
sp|P16677|PHNC_ECOLI Phosphonates import ATP-binding protein PhnC OS=Escherichia coli (strain K12) GN=phnC PE=3 SV=2 65 290 3.0E-07
sp|P25371|ADP1_YEAST Probable ATP-dependent permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADP1 PE=1 SV=2 372 651 4.0E-07
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 91 290 4.0E-07
sp|Q2SIN5|MSBA_HAHCH Lipid A export ATP-binding/permease protein MsbA OS=Hahella chejuensis (strain KCTC 2396) GN=msbA PE=3 SV=1 711 933 4.0E-07
sp|O34510|YFMF_BACSU Fe(3+)-citrate import ATP-binding protein YfmF OS=Bacillus subtilis (strain 168) GN=yfmF PE=3 SV=1 713 951 4.0E-07
sp|Q1GAD3|PSTB_LACDA Phosphate import ATP-binding protein PstB OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=pstB PE=3 SV=1 714 939 4.0E-07
sp|Q6LHL2|MODC_PHOPR Molybdenum import ATP-binding protein ModC OS=Photobacterium profundum GN=modC PE=3 SV=1 717 920 5.0E-07
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 83 291 5.0E-07
sp|O57872|Y132_PYRHO Putative ABC transporter ATP-binding protein PH0132 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0132 PE=3 SV=1 83 290 6.0E-07
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 84 284 6.0E-07
sp|Q0B5V4|ARAG2_BURCM Arabinose import ATP-binding protein AraG 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=araG2 PE=3 SV=1 84 283 6.0E-07
sp|Q8CUY0|PHNC2_OCEIH Phosphonates import ATP-binding protein PhnC 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=phnC2 PE=3 SV=1 81 289 7.0E-07
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 84 284 7.0E-07
sp|Q9LSJ2|AB22B_ARATH ABC transporter B family member 22 OS=Arabidopsis thaliana GN=ABCB22 PE=3 SV=2 709 902 8.0E-07
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 96 290 8.0E-07
sp|Q897I2|Y753_CLOTE Putative ABC transporter ATP-binding protein CTC_00753 OS=Clostridium tetani (strain Massachusetts / E88) GN=CTC_00753 PE=3 SV=1 182 290 1.0E-06
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 99 291 1.0E-06
sp|Q9LSJ5|AB18B_ARATH ABC transporter B family member 18 OS=Arabidopsis thaliana GN=ABCB18 PE=3 SV=1 709 902 1.0E-06
sp|Q0SFY5|METN1_RHOJR Methionine import ATP-binding protein MetN 1 OS=Rhodococcus jostii (strain RHA1) GN=metN1 PE=3 SV=1 80 289 1.0E-06
sp|Q54T02|ABCGO_DICDI ABC transporter G family member 24 OS=Dictyostelium discoideum GN=abcG24 PE=3 SV=1 369 602 2.0E-06
sp|Q21NS8|MSBA_SACD2 Lipid A export ATP-binding/permease protein MsbA OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=msbA PE=3 SV=1 714 902 2.0E-06
sp|P0AAG3|GLTL_ECOLI Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli (strain K12) GN=gltL PE=3 SV=1 101 265 2.0E-06
sp|P0AAG4|GLTL_ECO57 Glutamate/aspartate transport ATP-binding protein GltL OS=Escherichia coli O157:H7 GN=gltL PE=3 SV=1 101 265 2.0E-06
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 83 291 2.0E-06
sp|Q8PY26|Y1038_METMA Putative ABC transporter ATP-binding protein MM_1038 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_1038 PE=3 SV=2 81 291 2.0E-06
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 84 264 3.0E-06
sp|Q38WL5|METN_LACSS Methionine import ATP-binding protein MetN OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=metN PE=3 SV=1 84 265 3.0E-06
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 95 264 4.0E-06
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 65 284 4.0E-06
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 782 901 6.0E-06
sp|Q8TQ05|Y1747_METAC Putative ABC transporter ATP-binding protein MA_1747 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=MA_1747 PE=3 SV=1 715 956 8.0E-06
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 83 284 8.0E-06
sp|Q1LLP5|UGPC_CUPMC sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ugpC PE=3 SV=1 713 876 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0005524 ATP binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0016020 membrane Yes
GO:0043167 ion binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097367 carbohydrate derivative binding No
GO:0097159 organic cyclic compound binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0022804 active transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0000166 nucleotide binding No
GO:0005215 transporter activity No
GO:0015399 primary active transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 398 420 22
2 432 451 19
3 511 533 22
4 540 562 22
5 631 653 22
6 1055 1077 22
7 1134 1156 22
8 1163 1185 22
9 1195 1217 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 7 Decorating

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4841
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02170
Ophiocordyceps camponoti-rufipedis Ophun1|1468 (this protein)
Ophiocordyceps kimflemingae Ophio5|3036
Ophiocordyceps kimflemingae Ophio5|3037
Ophiocordyceps subramaniannii Hirsu2|10837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1468
MADTADGQVHRRTGEDSSDEDIVRPARHDNDSLSLDDVAPVAVQMRNLCVSISRSSSFLKYRDFIPKLIKSSDAA
SLTDTTPLLHSVTTDLPPSSLTAIVGGSGSGKTTLLNALAERTFSSGWSQTGTVTFNGEPGVTTVRHAYVTQQDI
FLPTLTVRETLQYAAELRLPASTPAHARHTVVEEVIRELGLRDCADTRLGNSQHRGCSGGEKRRVSIGVQLLANP
SVLFLDEPTTGLDASSAFQVVSLLEGLARKGRTVVMTVHQPRSEMWHLFDNLIVLSRGSPVYCGSRTGCLSWFRA
QGFHDPPFVNPADHIVDTSAVDSRTPQLEEESLARVAGLKAAWQTESASHFGPMELIPCKDGRPGRQWKVTQSPA
GFVRQLRVLTGRTLKVTFRDRLGMAASVLEGLLMGLLTGCLFYDVGRDQAGIRSRQGALFTAAGLQGYLVLIFEV
YRMTMDISVFDREAADGCVDPIPFILSRRLARLPTEDIPVPLLYTTLFYFMAGFDHDASKFFVLFIVTLLSHYIA
VMCAMTCVVAVRNFSGASLMANMVFTLQNLACGMLVQSNSIPVYVRWLKWITYTFYAFGAYTANEFQGSFYDCPD
PRGDSSLACAPYTGEFVMASLGFPTDWIARPMTAMAAFIVFFSVLSALGLHLFKPGLAVAGSRASDNRQSDCRNE
TTVSRSSIGRTVDLSLRSFALALDKRTLLGKRLPRKTILEPINASFPAGVLNVIMGPSGSGKTSLLDSMALRLRN
SMGTEYKRSGSMTLNGALPTDAVVRAVCSYVCQEDDALLPSLTVRETLRFAAGLRLPASMSAADKKRRADEVLMR
MGLKDCADTLIGSDIVKGISGGEKRRVSIAIQILTDPRILMLDEPTSGLDAFTARSILTVLSGLADEGRTIILTI
HQARSDLFDSFGNVLLLARGGETVFTGPARDMLGYLSGRGHECSRQMNPADFALDLVTVDLRSGDKEKKSRSRVQ
SLIEGWKAYQIEQQISNQGWETTENKEGSRSTTTDSLPASRQTNLPAELGALVRKPASFSTALPLLLHRATLNTR
RQPALLSARTTQVLGFSLVLVLFFTPLKSDYIAVQNRMGLMQELGALYFIGMLQNVAVYPDERDVFYREADDGVY
GVPAFLASYTIVETPFEIVSSLLFAVLVVFVVGLPRTVTMWLVSAFICFGIVSCGESLGIMFNTLFRHTGFAVNL
MGIVLAVANVMAGIVSIDMPGPFQAVNYLSPIRYAVRAVAPYAFRGLSLTCSAAQRLPEGICPVQTGEQALELYK
LDVDPIMPLEAFKVIIVGGSITGLTLAHSLHRIGVDYIVLEKRSEIVLQEGASIGILPNGARILDQLGLYTLIEQ
ATGSFGASNLYFPDGFRFRSLYPTRVFENFGYPISFMERRRLLDILYTALPDKTKVKTGKHVIGVERETRGEKGN
TFELETRCGGF*
Coding >Ophun1|1468
ATGGCAGACACCGCCGATGGCCAAGTTCACCGCAGAACTGGCGAGGATTCTTCCGACGAGGACATCGTCAGGCCC
GCAAGACATGACAATGACAGCCTTTCCCTTGACGATGTCGCCCCCGTCGCCGTTCAGATGCGCAATCTATGCGTT
TCTATCAGCCGGTCCTCGTCCTTCCTCAAGTATCGAGACTTCATACCGAAGCTCATCAAGTCATCCGATGCCGCG
TCTCTCACGGACACGACACCGTTACTTCACTCGGTAACGACAGATCTGCCCCCCAGCTCCCTTACTGCCATCGTC
GGAGGCAGCGGCTCAGGCAAAACGACGCTTCTCAACGCCCTGGCAGAGCGAACATTCAGCTCAGGATGGAGCCAG
ACCGGTACGGTGACCTTCAACGGCGAACCAGGCGTCACTACCGTCCGACACGCCTACGTGACGCAGCAAGACATC
TTTCTGCCGACGCTGACGGTCCGAGAGACCTTGCAGTACGCAGCGGAGCTCCGTCTGCCAGCCAGCACGCCCGCT
CACGCCCGCCACACCGTCGTTGAAGAAGTCATCCGTGAGCTCGGTCTCCGGGACTGCGCGGACACGCGTCTGGGA
AATAGCCAGCACCGTGGATGCTCAGGGGGCGAGAAGCGGAGGGTGAGTATCGGCGTGCAGCTGCTGGCCAATCCG
TCGGTTTTGTTCCTGGATGAGCCGACGACCGGTCTCGATGCCAGCAGCGCTTTCCAGGTCGTTAGTCTTCTGGAG
GGTCTCGCCCGTAAGGGACGAACTGTCGTCATGACGGTCCATCAGCCGCGGTCCGAGATGTGGCATCTGTTTGAT
AATCTCATCGTTTTGTCTCGTGGCAGCCCGGTATACTGCGGTTCGAGGACCGGTTGTCTGTCCTGGTTTAGGGCT
CAGGGCTTCCACGATCCGCCCTTTGTCAACCCGGCTGATCATATCGTCGACACTTCGGCCGTCGATAGCCGCACT
CCACAGCTAGAGGAGGAGAGTCTGGCTCGAGTGGCGGGTCTGAAGGCTGCGTGGCAGACCGAAAGCGCATCTCAT
TTTGGGCCGATGGAGTTGATACCTTGCAAGGACGGCAGACCGGGCCGGCAATGGAAAGTTACACAGTCGCCCGCC
GGCTTCGTTCGCCAGCTGCGAGTTCTCACGGGCCGGACTCTGAAGGTGACGTTTCGGGATCGTCTCGGTATGGCG
GCCTCGGTGCTGGAAGGCCTCCTGATGGGACTTCTGACCGGCTGTTTGTTCTATGACGTCGGCCGCGACCAGGCC
GGTATTCGATCACGACAGGGGGCGTTGTTCACGGCAGCCGGTCTGCAGGGCTATCTGGTCCTCATATTCGAGGTC
TATCGCATGACTATGGACATAAGCGTCTTTGACCGTGAGGCGGCAGACGGCTGCGTCGACCCGATACCGTTCATT
CTCTCCCGTCGTCTGGCCAGGCTGCCAACAGAGGATATACCAGTCCCGCTGCTTTACACGACCCTCTTTTACTTC
ATGGCCGGCTTCGACCACGATGCAAGCAAATTCTTCGTCCTTTTCATCGTCACGTTGCTCAGCCACTACATCGCC
GTCATGTGCGCCATGACGTGCGTCGTCGCCGTGAGAAACTTCTCCGGAGCGAGCCTCATGGCCAATATGGTCTTT
ACGCTGCAGAATTTGGCGTGTGGAATGCTGGTCCAGAGCAACTCGATCCCGGTGTACGTGCGCTGGCTGAAATGG
ATCACCTATACCTTCTATGCCTTTGGTGCTTACACGGCCAACGAGTTTCAGGGCAGCTTCTACGACTGTCCGGAT
CCTCGCGGCGACTCGAGCCTTGCCTGCGCCCCCTACACGGGCGAGTTTGTCATGGCGTCTCTGGGCTTCCCTACG
GACTGGATCGCGCGTCCGATGACGGCAATGGCGGCTTTCATCGTCTTCTTCAGCGTCTTGTCGGCTCTCGGACTG
CATCTCTTTAAGCCCGGCCTCGCCGTCGCCGGTTCTCGAGCGTCGGACAATCGTCAGTCTGACTGCCGCAATGAG
ACGACCGTGTCGAGGTCCTCGATCGGCAGAACTGTCGACTTGAGCTTGCGCAGTTTTGCCCTGGCATTGGATAAG
CGGACTCTGCTCGGTAAGAGGCTGCCTCGCAAGACGATCCTCGAGCCCATCAACGCCAGCTTTCCGGCCGGTGTC
CTCAACGTCATTATGGGCCCGTCAGGCAGCGGGAAGACGTCGCTGCTTGACTCGATGGCCCTACGACTGCGAAAT
TCGATGGGCACCGAGTACAAACGATCCGGTAGCATGACGCTTAACGGCGCCTTACCCACCGACGCCGTCGTCCGA
GCCGTCTGTTCCTACGTCTGTCAGGAGGATGATGCTCTTCTGCCTTCGCTGACTGTGCGGGAGACGCTCCGGTTC
GCGGCCGGTTTGCGTCTGCCGGCATCAATGAGCGCGGCTGATAAGAAGCGAAGAGCGGACGAGGTGCTGATGAGG
ATGGGCTTGAAAGATTGTGCCGACACTCTGATCGGGAGCGATATAGTCAAGGGTATCTCAGGCGGAGAGAAGCGG
CGGGTCTCCATTGCCATTCAGATCCTCACCGACCCTCGCATCTTGATGCTCGACGAGCCTACCTCGGGACTCGAT
GCCTTCACCGCCAGGTCCATCCTGACCGTCCTCAGCGGCCTTGCCGACGAGGGCCGCACCATCATCTTGACCATC
CACCAAGCCCGTTCCGACCTGTTTGATAGCTTCGGCAACGTCCTGCTGCTTGCCCGCGGGGGGGAGACGGTCTTC
ACTGGGCCAGCGAGGGACATGCTCGGATATCTGAGTGGTCGTGGTCATGAATGCTCACGCCAGATGAACCCGGCT
GACTTTGCTTTGGATCTGGTCACCGTTGACCTCCGGTCAGGGGATAAGGAGAAGAAGAGCCGGTCAAGGGTGCAG
AGCTTGATAGAAGGCTGGAAGGCGTATCAAATCGAGCAGCAAATCAGCAACCAAGGCTGGGAAACAACCGAGAAT
AAGGAAGGCTCCAGATCCACGACCACCGACAGTCTTCCAGCCTCCCGACAGACCAACTTGCCCGCCGAGCTCGGC
GCCCTCGTCCGCAAACCAGCAAGCTTCAGCACCGCCCTCCCCCTTCTCCTCCACCGAGCAACGCTCAACACCCGC
CGCCAGCCAGCGCTCCTCAGCGCGCGGACAACGCAGGTGCTGGGCTTCAGCCTCGTCCTCGTCCTCTTCTTCACG
CCCCTGAAGAGCGACTACATCGCGGTGCAGAACCGGATGGGGCTAATGCAGGAGCTTGGAGCGCTGTACTTTATC
GGCATGCTGCAGAATGTTGCTGTCTATCCGGATGAGCGCGATGTCTTTTACCGCGAGGCTGATGATGGAGTCTAC
GGCGTGCCTGCTTTCCTGGCGTCTTATACTATTGTCGAGACGCCGTTTGAGATTGTCAGCAGCTTGCTCTTCGCC
GTCTTGGTCGTCTTTGTCGTTGGCTTGCCTCGGACCGTCACCATGTGGCTCGTCAGCGCCTTCATCTGCTTCGGC
ATCGTCTCTTGCGGTGAGAGCCTGGGCATCATGTTCAACACACTCTTCAGACACACGGGTTTCGCCGTCAACCTC
ATGGGCATTGTCCTGGCCGTGGCCAACGTCATGGCCGGCATCGTTTCCATCGACATGCCTGGCCCGTTTCAGGCC
GTCAACTACCTCTCACCCATCCGCTATGCTGTCCGGGCGGTGGCCCCCTACGCGTTCCGCGGCTTGAGTCTCACA
TGCAGCGCCGCCCAGCGGCTTCCGGAGGGCATCTGTCCGGTCCAGACGGGGGAGCAGGCGCTGGAGCTGTATAAG
CTCGACGTGGATCCTATCATGCCCCTCGAAGCCTTCAAGGTCATTATCGTCGGCGGCTCCATCACGGGCCTCACG
CTGGCTCACAGCCTGCATCGAATCGGGGTCGACTACATTGTTCTAGAGAAGAGGTCCGAGATTGTGCTGCAAGAG
GGAGCTTCCATCGGCATCCTACCCAACGGAGCGCGGATCCTAGACCAGCTCGGTCTGTACACGTTGATTGAGCAG
GCTACGGGATCTTTCGGGGCGTCGAATCTCTACTTTCCTGATGGCTTTCGGTTTAGGAGCTTGTATCCTACGAGG
GTGTTTGAGAACTTCGGATATCCCATCTCATTCATGGAAAGAAGAAGACTGCTCGACATTCTCTACACTGCCCTC
CCCGACAAGACAAAGGTCAAGACTGGCAAACACGTCATCGGCGTCGAAAGAGAGACACGGGGAGAGAAGGGCAAT
ACATTCGAGTTAGAGACGAGATGTGGCGGCTTTTAG
Transcript >Ophun1|1468
ATGGCAGACACCGCCGATGGCCAAGTTCACCGCAGAACTGGCGAGGATTCTTCCGACGAGGACATCGTCAGGCCC
GCAAGACATGACAATGACAGCCTTTCCCTTGACGATGTCGCCCCCGTCGCCGTTCAGATGCGCAATCTATGCGTT
TCTATCAGCCGGTCCTCGTCCTTCCTCAAGTATCGAGACTTCATACCGAAGCTCATCAAGTCATCCGATGCCGCG
TCTCTCACGGACACGACACCGTTACTTCACTCGGTAACGACAGATCTGCCCCCCAGCTCCCTTACTGCCATCGTC
GGAGGCAGCGGCTCAGGCAAAACGACGCTTCTCAACGCCCTGGCAGAGCGAACATTCAGCTCAGGATGGAGCCAG
ACCGGTACGGTGACCTTCAACGGCGAACCAGGCGTCACTACCGTCCGACACGCCTACGTGACGCAGCAAGACATC
TTTCTGCCGACGCTGACGGTCCGAGAGACCTTGCAGTACGCAGCGGAGCTCCGTCTGCCAGCCAGCACGCCCGCT
CACGCCCGCCACACCGTCGTTGAAGAAGTCATCCGTGAGCTCGGTCTCCGGGACTGCGCGGACACGCGTCTGGGA
AATAGCCAGCACCGTGGATGCTCAGGGGGCGAGAAGCGGAGGGTGAGTATCGGCGTGCAGCTGCTGGCCAATCCG
TCGGTTTTGTTCCTGGATGAGCCGACGACCGGTCTCGATGCCAGCAGCGCTTTCCAGGTCGTTAGTCTTCTGGAG
GGTCTCGCCCGTAAGGGACGAACTGTCGTCATGACGGTCCATCAGCCGCGGTCCGAGATGTGGCATCTGTTTGAT
AATCTCATCGTTTTGTCTCGTGGCAGCCCGGTATACTGCGGTTCGAGGACCGGTTGTCTGTCCTGGTTTAGGGCT
CAGGGCTTCCACGATCCGCCCTTTGTCAACCCGGCTGATCATATCGTCGACACTTCGGCCGTCGATAGCCGCACT
CCACAGCTAGAGGAGGAGAGTCTGGCTCGAGTGGCGGGTCTGAAGGCTGCGTGGCAGACCGAAAGCGCATCTCAT
TTTGGGCCGATGGAGTTGATACCTTGCAAGGACGGCAGACCGGGCCGGCAATGGAAAGTTACACAGTCGCCCGCC
GGCTTCGTTCGCCAGCTGCGAGTTCTCACGGGCCGGACTCTGAAGGTGACGTTTCGGGATCGTCTCGGTATGGCG
GCCTCGGTGCTGGAAGGCCTCCTGATGGGACTTCTGACCGGCTGTTTGTTCTATGACGTCGGCCGCGACCAGGCC
GGTATTCGATCACGACAGGGGGCGTTGTTCACGGCAGCCGGTCTGCAGGGCTATCTGGTCCTCATATTCGAGGTC
TATCGCATGACTATGGACATAAGCGTCTTTGACCGTGAGGCGGCAGACGGCTGCGTCGACCCGATACCGTTCATT
CTCTCCCGTCGTCTGGCCAGGCTGCCAACAGAGGATATACCAGTCCCGCTGCTTTACACGACCCTCTTTTACTTC
ATGGCCGGCTTCGACCACGATGCAAGCAAATTCTTCGTCCTTTTCATCGTCACGTTGCTCAGCCACTACATCGCC
GTCATGTGCGCCATGACGTGCGTCGTCGCCGTGAGAAACTTCTCCGGAGCGAGCCTCATGGCCAATATGGTCTTT
ACGCTGCAGAATTTGGCGTGTGGAATGCTGGTCCAGAGCAACTCGATCCCGGTGTACGTGCGCTGGCTGAAATGG
ATCACCTATACCTTCTATGCCTTTGGTGCTTACACGGCCAACGAGTTTCAGGGCAGCTTCTACGACTGTCCGGAT
CCTCGCGGCGACTCGAGCCTTGCCTGCGCCCCCTACACGGGCGAGTTTGTCATGGCGTCTCTGGGCTTCCCTACG
GACTGGATCGCGCGTCCGATGACGGCAATGGCGGCTTTCATCGTCTTCTTCAGCGTCTTGTCGGCTCTCGGACTG
CATCTCTTTAAGCCCGGCCTCGCCGTCGCCGGTTCTCGAGCGTCGGACAATCGTCAGTCTGACTGCCGCAATGAG
ACGACCGTGTCGAGGTCCTCGATCGGCAGAACTGTCGACTTGAGCTTGCGCAGTTTTGCCCTGGCATTGGATAAG
CGGACTCTGCTCGGTAAGAGGCTGCCTCGCAAGACGATCCTCGAGCCCATCAACGCCAGCTTTCCGGCCGGTGTC
CTCAACGTCATTATGGGCCCGTCAGGCAGCGGGAAGACGTCGCTGCTTGACTCGATGGCCCTACGACTGCGAAAT
TCGATGGGCACCGAGTACAAACGATCCGGTAGCATGACGCTTAACGGCGCCTTACCCACCGACGCCGTCGTCCGA
GCCGTCTGTTCCTACGTCTGTCAGGAGGATGATGCTCTTCTGCCTTCGCTGACTGTGCGGGAGACGCTCCGGTTC
GCGGCCGGTTTGCGTCTGCCGGCATCAATGAGCGCGGCTGATAAGAAGCGAAGAGCGGACGAGGTGCTGATGAGG
ATGGGCTTGAAAGATTGTGCCGACACTCTGATCGGGAGCGATATAGTCAAGGGTATCTCAGGCGGAGAGAAGCGG
CGGGTCTCCATTGCCATTCAGATCCTCACCGACCCTCGCATCTTGATGCTCGACGAGCCTACCTCGGGACTCGAT
GCCTTCACCGCCAGGTCCATCCTGACCGTCCTCAGCGGCCTTGCCGACGAGGGCCGCACCATCATCTTGACCATC
CACCAAGCCCGTTCCGACCTGTTTGATAGCTTCGGCAACGTCCTGCTGCTTGCCCGCGGGGGGGAGACGGTCTTC
ACTGGGCCAGCGAGGGACATGCTCGGATATCTGAGTGGTCGTGGTCATGAATGCTCACGCCAGATGAACCCGGCT
GACTTTGCTTTGGATCTGGTCACCGTTGACCTCCGGTCAGGGGATAAGGAGAAGAAGAGCCGGTCAAGGGTGCAG
AGCTTGATAGAAGGCTGGAAGGCGTATCAAATCGAGCAGCAAATCAGCAACCAAGGCTGGGAAACAACCGAGAAT
AAGGAAGGCTCCAGATCCACGACCACCGACAGTCTTCCAGCCTCCCGACAGACCAACTTGCCCGCCGAGCTCGGC
GCCCTCGTCCGCAAACCAGCAAGCTTCAGCACCGCCCTCCCCCTTCTCCTCCACCGAGCAACGCTCAACACCCGC
CGCCAGCCAGCGCTCCTCAGCGCGCGGACAACGCAGGTGCTGGGCTTCAGCCTCGTCCTCGTCCTCTTCTTCACG
CCCCTGAAGAGCGACTACATCGCGGTGCAGAACCGGATGGGGCTAATGCAGGAGCTTGGAGCGCTGTACTTTATC
GGCATGCTGCAGAATGTTGCTGTCTATCCGGATGAGCGCGATGTCTTTTACCGCGAGGCTGATGATGGAGTCTAC
GGCGTGCCTGCTTTCCTGGCGTCTTATACTATTGTCGAGACGCCGTTTGAGATTGTCAGCAGCTTGCTCTTCGCC
GTCTTGGTCGTCTTTGTCGTTGGCTTGCCTCGGACCGTCACCATGTGGCTCGTCAGCGCCTTCATCTGCTTCGGC
ATCGTCTCTTGCGGTGAGAGCCTGGGCATCATGTTCAACACACTCTTCAGACACACGGGTTTCGCCGTCAACCTC
ATGGGCATTGTCCTGGCCGTGGCCAACGTCATGGCCGGCATCGTTTCCATCGACATGCCTGGCCCGTTTCAGGCC
GTCAACTACCTCTCACCCATCCGCTATGCTGTCCGGGCGGTGGCCCCCTACGCGTTCCGCGGCTTGAGTCTCACA
TGCAGCGCCGCCCAGCGGCTTCCGGAGGGCATCTGTCCGGTCCAGACGGGGGAGCAGGCGCTGGAGCTGTATAAG
CTCGACGTGGATCCTATCATGCCCCTCGAAGCCTTCAAGGTCATTATCGTCGGCGGCTCCATCACGGGCCTCACG
CTGGCTCACAGCCTGCATCGAATCGGGGTCGACTACATTGTTCTAGAGAAGAGGTCCGAGATTGTGCTGCAAGAG
GGAGCTTCCATCGGCATCCTACCCAACGGAGCGCGGATCCTAGACCAGCTCGGTCTGTACACGTTGATTGAGCAG
GCTACGGGATCTTTCGGGGCGTCGAATCTCTACTTTCCTGATGGCTTTCGGTTTAGGAGCTTGTATCCTACGAGG
GTGTTTGAGAACTTCGGATATCCCATCTCATTCATGGAAAGAAGAAGACTGCTCGACATTCTCTACACTGCCCTC
CCCGACAAGACAAAGGTCAAGACTGGCAAACACGTCATCGGCGTCGAAAGAGAGACACGGGGAGAGAAGGGCAAT
ACATTCGAGTTAGAGACGAGATGTGGCGGCTTTTAG
Gene >Ophun1|1468
ATGGCAGACACCGCCGATGGCCAAGTTCACCGCAGAACTGGCGAGGATTCTTCCGACGAGGACATCGTCAGGCCC
GCAAGACATGACAATGACAGCCTTTCCCTTGACGATGTCGCCCCCGTCGCCGTTCAGATGCGCAATCTATGCGTT
TCTATCAGCCGGTCCTCGTCCTTCCTCAAGTATCGAGACTTCATACCGAAGCTCATCAAGTCATCCGATGCCGCG
TCTCTCACGGACACGACACCGTTACTTCACTCGGTAACGACAGATCTGCCCCCCAGCTCCCTTACTGCCATCGTC
GGAGGCAGCGGCTCAGGCAAAACGACGCTTCTCAACGCCCTGGCAGAGCGAACATTCAGCTCAGGATGGAGCCAG
ACCGGTACGGTGACCTTCAACGGCGAACCAGGCGTCACTACCGTCCGACACGCCTACGTGACGCAGCAAGACATC
TTTCTGCCGACGCTGACGGTCCGAGAGACCTTGCAGTACGCAGCGGAGCTCCGTCTGCCAGCCAGCACGCCCGCT
CACGCCCGCCACACCGTCGTTGAAGAAGTCATCCGTGAGCTCGGTCTCCGGGACTGCGCGGACACGCGTCTGGGA
AATAGCCAGCACCGTGGATGCTCAGGGGGCGAGAAGCGGAGGGTGAGTATCGGCGTGCAGCTGCTGGCCAATCCG
TCGGTTTTGTTCCTGGATGAGCCGACGACCGGTCTCGATGCCAGCAGCGCTTTCCAGGTCGTTAGTCTTCTGGAG
GGTCTCGCCCGTAAGGGACGAACTGTCGTCATGACGGTCCATCAGCCGCGGTCCGAGATGTGGCATCTGTTTGAT
AATCTCATCGTTTTGTCTCGTGGCAGCCCGGTATACTGCGGTTCGAGGACCGGTTGTCTGTCCTGGTTTAGGGCT
CAGGGCTTCCACGATCCGCCCTTTGTCAACCCGGCTGATCATATCGTCGACACTTCGGCCGTCGATAGCCGCACT
CCACAGCTAGAGGAGGAGAGTCTGGCTCGAGTGGCGGGTCTGAAGGCTGCGTGGCAGACCGAAAGCGCATCTCAT
TTTGGGCCGATGGAGTTGATACCTTGCAAGGACGGCAGACCGGGCCGGCAATGGAAAGTTACACAGTCGCCCGCC
GGCTTCGTTCGCCAGCTGCGAGTTCTCACGGGCCGGACTCTGAAGGTGACGTTTCGGGATCGTCTCGGTATGGCG
GCCTCGGTGCTGGAAGGCCTCCTGATGGGACTTCTGACCGGCTGTTTGTTCTATGACGTCGGCCGCGACCAGGCC
GGTATTCGATCACGACAGGGGGCGTTGTTCACGGCAGCCGGTCTGCAGGGCTATCTGGTCCTCATATTCGAGGTC
TATCGCATGACTATGGACATAAGCGTCTTTGACCGTGAGGCGGCAGACGGCTGCGTCGACCCGATACCGTTCATT
CTCTCCCGTCGTCTGGCCAGGCTGCCAACAGAGGATATACCAGTCCCGCTGCTTTACACGACCCTCTTTTACTTC
ATGGCCGGCTTCGACCACGATGCAAGCAAATTCTTCGTCCTTTTCATCGTCACGTTGCTCAGCCACTACATCGCC
GTCATGTGCGCCATGACGTGCGTCGTCGCCGTGAGAAACTTCTCCGGAGCGAGCCTCATGGCCAATATGGTCTTT
ACGCTGCAGAATTTGGCGTGTGGAATGCTGGTCCAGAGCAACTCGATCCCGGTGTACGTGCGCTGGCTGAAATGG
ATCACCTATACCGTGAGTTCTGGGGAGACTAAATTACGCATATCTACGTCTGACCGTGTTCTAGTTCTATGCCTT
TGGTGCTTACACGGCCAACGAGTTTCAGGGCAGCTTCTACGACTGTCCGGATCCTCGCGGCGACTCGAGCCTTGC
CTGCGCCCCCTACACGGGCGAGTTTGTCATGGCGTCTCTGGGCTTCCCTACGGACTGGATCGCGCGTCCGATGAC
GGCAATGGCGGCTTTCATCGTCTTCTTCAGCGTCTTGTCGGCTCTCGGACTGCATCTCTTTAAGCCCGGCCTCGC
CGTCGCCGGTTCTCGAGCGTCGGACAATCGTCAGTCTGACTGCCGCAATGAGACGACCGTGTCGAGGTCCTCGAT
CGGCAGAACTGTCGACTTGAGCTTGCGCAGTTTTGCCCTGGCATTGGATAAGCGGACTCTGCTCGGTAAGAGGCT
GCCTCGCAAGACGATCCTCGAGCCCATCAACGCCAGCTTTCCGGCCGGTGTCCTCAACGTCATTATGGGCCCGTC
AGGCAGCGGGAAGACGTCGCTGCTTGACTCGATGGCCCTACGACTGCGAAATTCGATGGGCACCGAGTACAAACG
ATCCGGTAGCATGACGCTTAACGGCGCCTTACCCACCGACGCCGTCGTCCGAGCCGTCTGTTCCTACGTCTGTCA
GGAGGATGATGCTCTTCTGCCTTCGCTGACTGTGCGGGAGACGCTCCGGTTCGCGGCCGGTTTGCGTCTGCCGGC
ATCAATGAGCGCGGCTGATAAGAAGCGAAGAGCGGACGAGGTGCTGATGAGGATGGGCTTGAAAGATTGTGCCGA
CACTCTGATCGGGAGCGATATAGTCAAGGGTATCTCAGGCGGAGAGAAGCGGCGGGTCTCCATTGCCATTCAGAT
CCTCACCGACCCTCGCATCTTGATGCTCGACGAGCCTACCTCGGGACTCGATGCCTTCACCGCCAGGTCCATCCT
GACCGTCCTCAGCGGCCTTGCCGACGAGGGCCGCACCATCATCTTGACCATCCACCAAGCCCGTTCCGACCTGTT
TGATAGCTTCGGCAACGTCCTGCTGCTTGCCCGCGGGGGGGAGACGGTCTTCACTGGGCCAGCGAGGGACATGCT
CGGATATCTGAGTGGTCGTGGTCATGAATGCTCACGCCAGATGAACCCGGCTGACTTTGCTTTGGATCTGGTCAC
CGTTGACCTCCGGTCAGGGGATAAGGAGAAGAAGAGCCGGTCAAGGGTGCAGAGCTTGATAGAAGGCTGGAAGGC
GTATCAAATCGAGCAGCAAATCAGCAACCAAGGCTGGGAAACAACCGAGAATAAGGAAGGCTCCAGATCCACGAC
CACCGACAGTCTTCCAGCCTCCCGACAGACCAACTTGCCCGCCGAGCTCGGCGCCCTCGTCCGCAAACCAGCAAG
CTTCAGCACCGCCCTCCCCCTTCTCCTCCACCGAGCAACGCTCAACACCCGCCGCCAGCCAGCGCTCCTCAGCGC
GCGGACAACGCAGGTGCTGGGCTTCAGCCTCGTCCTCGTCCTCTTCTTCACGCCCCTGAAGAGCGACTACATCGC
GGTGCAGAACCGGATGGGGCTAATGCAGGAGCTTGGAGCGCTGTACTTTATCGGCATGCTGCAGAATGTTGCTGT
CTATCCGGATGAGCGCGATGTCTTTTACCGCGAGGCTGATGATGGAGTCTACGGCGTGCCTGCTTTCCTGGCGTC
TTATACTATTGTCGAGACGCCGTTTGAGATTGTCAGCAGCTTGCTCTTCGCCGTCTTGGTCGTCTTTGTCGTTGG
CTTGCCTCGGACCGTCACCATGTGGCTCGTCAGCGCCTTCATCTGCTTCGGCATCGTCTCTTGCGGTGAGAGCCT
GGGCATCATGTTCAACACACTCTTCAGACACACGGGTTTCGCCGTCAACCTCATGGGCATTGTCCTGGCCGTGGC
CAACGTCATGGCCGGCATCGTTTCCATCGACATGCCTGGCCCGTTTCAGGCCGTCAACTACCTCTCACCCATCCG
CTATGCTGTCCGGGCGGTGGCCCCCTACGCGTTCCGCGGCTTGAGTCTCACATGCAGCGCCGCCCAGCGGCTTCC
GGAGGGCATCTGTCCGGTCCAGACGGGGGAGCAGGCGCTGGAGCTGTATAAGCTCGACGTGGATCCTATCGTGAG
CGTGGCGGCTATGGCGGGCTGTGTCTTGGTTTATCGCGCCTTGGCAGTTGGTCTCTTGCTTTTGGTGAGGAGATG
GAAGTTGAGATGATAATGTCTCAAGAAGGGGCGAAGACTGTTGAGACCCCTTTCGGATACGAAGTGCTGTTGTAC
TGAGTGAGTCCTGGGATTCCATGTACATTAATTGTGACTTGACCAGCGTCGAGCCGCGTTCACTCGGCGATTTAA
GGGAGTCTTTGTCTTGGGAGGTGGGAGAAGGACGCTTTCATTAGACAGTATTCGTATCTCAGCGGCAAAGGGCCC
AGTAGAGTGGAAGGTATTCGAACAGGCCTATCACAAAGTCGCCGAAGAAATCTTGGCCAGGAGTCCTCAAACTCG
AGCCCCCTGGCCTTGACTTCTGTCCCCCTCTGACTCCTCCCATCGCTACTCGTGAAACAGGTCCTCTCATGACAA
AAGAGCCTGTAAGATGCCCCTCGAAGCCTTCAAGGTCATTATCGTCGGCGGCTCCATCACGGGCCTCACGCTGGC
TCACAGCCTGCATCGAATCGGGGTCGACTACATTGTTCTAGAGAAGAGGTCCGAGATTGTGCTGCAAGAGGGAGC
TTCCATCGGCATCCTACCCAACGGAGCGCGGATCCTAGACCAGCTCGGTCTGTACACGTTGATTGAGCAGGCTAC
GGGATCTTTCGGGGCGTCGAATCTCTACTTTCCTGATGGCTTTCGGTTTAGGAGCTTGTATCCTACGAGGGTGTT
TGAGAAGTACGTTGAGTCGAGGGCGTAGAACCGGAGCCGTTCTGAGTTAACATTTGTCCTCTCACAGCTTCGGAT
ATCCCATCTCATTCATGGAAAGAAGAAGACTGCTCGACATTCTCTACACTGCCCTCCCCGACAAGACAAAGGTCA
AGACTGGCAAACACGTCATCGGCGTCGAAAGAGAGACACGGGGAGAGAAGGGCAATACATGTATCCGAGTCCGGA
CTGTGGATGGAGACGTCTACGACGGCGACCTCGTTGTCGGGGCTGACGGGGTGCACAGTCGAGTTAGAGACGAGA
TGTGGCGGCTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail