Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1464
Gene name
LocationContig_16:17856..18902
Strand-
Gene length (bp)1046
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01040 UbiA UbiA prenyltransferase family 1.2E-34 24 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q298G6|COQ2_DROPS 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Coq2 PE=3 SV=1 49 302 2.0E-20
sp|Q9VHS7|COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster GN=Coq2 PE=2 SV=1 49 303 4.0E-20
sp|Q8W404|PGT2_LITER 4-hydroxybenzoate geranyltransferase 2 OS=Lithospermum erythrorhizon GN=PGT-2 PE=1 SV=1 60 214 3.0E-19
sp|Q16QL3|COQ2_AEDAE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Aedes aegypti GN=coq2 PE=3 SV=1 53 302 4.0E-19
sp|Q8W405|PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon GN=PGT-1 PE=1 SV=1 60 214 6.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q298G6|COQ2_DROPS 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila pseudoobscura pseudoobscura GN=Coq2 PE=3 SV=1 49 302 2.0E-20
sp|Q9VHS7|COQ2_DROME 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Drosophila melanogaster GN=Coq2 PE=2 SV=1 49 303 4.0E-20
sp|Q8W404|PGT2_LITER 4-hydroxybenzoate geranyltransferase 2 OS=Lithospermum erythrorhizon GN=PGT-2 PE=1 SV=1 60 214 3.0E-19
sp|Q16QL3|COQ2_AEDAE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Aedes aegypti GN=coq2 PE=3 SV=1 53 302 4.0E-19
sp|Q8W405|PGT1_LITER 4-hydroxybenzoate geranyltransferase 1 OS=Lithospermum erythrorhizon GN=PGT-1 PE=1 SV=1 60 214 6.0E-19
sp|Q87KM9|UBIA_VIBPA 4-hydroxybenzoate octaprenyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiA PE=3 SV=1 53 245 8.0E-15
sp|Q96H96|COQ2_HUMAN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Homo sapiens GN=COQ2 PE=1 SV=1 53 297 1.0E-14
sp|Q87U39|UBIA_PSESM 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiA PE=3 SV=1 47 246 2.0E-14
sp|Q54U71|COQ2_DICDI 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Dictyostelium discoideum GN=coq2' PE=3 SV=1 47 302 3.0E-14
sp|B1J454|UBIA_PSEPW 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas putida (strain W619) GN=ubiA PE=3 SV=1 61 246 3.0E-14
sp|Q48BQ5|UBIA_PSE14 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ubiA PE=3 SV=1 53 246 3.0E-14
sp|Q3K4G3|UBIA_PSEPF 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiA PE=3 SV=1 61 246 4.0E-14
sp|Q2KIQ4|COQ2_BOVIN 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Bos taurus GN=COQ2 PE=2 SV=1 53 302 4.0E-14
sp|A7N0X0|UBIA_VIBCB 4-hydroxybenzoate octaprenyltransferase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiA PE=3 SV=1 53 244 4.0E-14
sp|Q10252|COQ2_SCHPO 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppt1 PE=1 SV=2 44 232 5.0E-14
sp|B0BPA2|UBIA_ACTPJ 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ubiA PE=3 SV=1 60 238 7.0E-14
sp|Q66JT7|COQ2_MOUSE 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Mus musculus GN=Coq2 PE=2 SV=2 54 236 7.0E-14
sp|B3H1F9|UBIA_ACTP7 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiA PE=3 SV=1 60 238 7.0E-14
sp|A3N0I2|UBIA_ACTP2 4-hydroxybenzoate octaprenyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiA PE=3 SV=1 60 238 7.0E-14
sp|Q4ZLB4|UBIA_PSEU2 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=ubiA PE=3 SV=1 47 246 3.0E-13
sp|Q499N4|COQ2_RAT 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Rattus norvegicus GN=Coq2 PE=2 SV=1 54 214 5.0E-13
sp|Q3IHW5|UBIA_PSEHT 4-hydroxybenzoate octaprenyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiA PE=3 SV=1 61 227 6.0E-13
sp|P57970|UBIA_PASMU 4-hydroxybenzoate octaprenyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiA PE=3 SV=1 60 294 1.0E-12
sp|C3K4C4|UBIA_PSEFS 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiA PE=3 SV=1 61 246 2.0E-12
sp|P32378|COQ2_YEAST 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COQ2 PE=1 SV=1 49 302 3.0E-12
sp|B0KQB7|UBIA_PSEPG 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas putida (strain GB-1) GN=ubiA PE=3 SV=1 61 214 3.0E-12
sp|B6J612|UBIA_COXB1 4-hydroxybenzoate octaprenyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiA PE=3 SV=1 6 240 5.0E-12
sp|Q494A7|UBIA_BLOPB 4-hydroxybenzoate octaprenyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=ubiA PE=3 SV=1 50 214 5.0E-12
sp|Q83F93|UBIA_COXBU 4-hydroxybenzoate octaprenyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiA PE=3 SV=1 6 240 6.0E-12
sp|A9KGW7|UBIA_COXBN 4-hydroxybenzoate octaprenyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiA PE=3 SV=1 6 240 6.0E-12
sp|B6J375|UBIA_COXB2 4-hydroxybenzoate octaprenyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiA PE=3 SV=1 6 240 6.0E-12
sp|A9N9X0|UBIA_COXBR 4-hydroxybenzoate octaprenyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiA PE=3 SV=1 6 240 7.0E-12
sp|Q7MZB6|UBIA_PHOLL 4-hydroxybenzoate octaprenyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiA PE=3 SV=1 50 221 8.0E-12
sp|Q88C65|UBIA_PSEPK 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas putida (strain KT2440) GN=ubiA PE=3 SV=1 61 214 1.0E-11
sp|A5WB34|UBIA_PSEP1 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ubiA PE=3 SV=1 61 214 1.0E-11
sp|C5B704|UBIA_EDWI9 4-hydroxybenzoate octaprenyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=ubiA PE=3 SV=1 61 224 2.0E-11
sp|Q7MQ87|UBIA_VIBVY 4-hydroxybenzoate octaprenyltransferase OS=Vibrio vulnificus (strain YJ016) GN=ubiA PE=3 SV=1 61 222 2.0E-11
sp|Q15ZT9|UBIA_PSEA6 4-hydroxybenzoate octaprenyltransferase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=ubiA PE=3 SV=2 48 245 2.0E-11
sp|Q1I2R3|UBIA_PSEE4 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiA PE=3 SV=1 61 214 2.0E-11
sp|A6VEG6|UBIA_PSEA7 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiA PE=3 SV=1 57 214 3.0E-11
sp|Q8DD49|UBIA_VIBVU 4-hydroxybenzoate octaprenyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=ubiA PE=3 SV=1 61 222 3.0E-11
sp|A4VGN3|UBIA_PSEU5 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=ubiA PE=3 SV=1 60 246 4.0E-11
sp|A8FQF8|UBIA_SHESH 4-hydroxybenzoate octaprenyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=ubiA PE=3 SV=1 62 227 4.0E-11
sp|Q4K3L9|UBIA_PSEF5 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiA PE=3 SV=1 61 246 5.0E-11
sp|Q48AL9|UBIA_COLP3 4-hydroxybenzoate octaprenyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiA PE=3 SV=1 53 214 6.0E-11
sp|B7VMA0|UBIA_VIBTL 4-hydroxybenzoate octaprenyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=ubiA PE=3 SV=1 57 241 7.0E-11
sp|Q6D9I8|UBIA_PECAS 4-hydroxybenzoate octaprenyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiA PE=3 SV=1 52 244 7.0E-11
sp|Q5P5M0|UBIA_AROAE 4-hydroxybenzoate octaprenyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=ubiA PE=3 SV=2 61 251 7.0E-11
sp|B5FCB4|UBIA_VIBFM 4-hydroxybenzoate octaprenyltransferase OS=Vibrio fischeri (strain MJ11) GN=ubiA PE=3 SV=1 50 227 7.0E-11
sp|A0KSE2|UBIA_SHESA 4-hydroxybenzoate octaprenyltransferase OS=Shewanella sp. (strain ANA-3) GN=ubiA PE=3 SV=1 62 238 8.0E-11
sp|Q9HTK0|UBIA_PSEAE 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiA PE=3 SV=1 57 214 9.0E-11
sp|B7V5P9|UBIA_PSEA8 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiA PE=3 SV=1 57 214 9.0E-11
sp|O52366|UBIA_PROST 4-hydroxybenzoate octaprenyltransferase OS=Providencia stuartii GN=ubiA PE=3 SV=1 54 238 9.0E-11
sp|A6W3L5|UBIA_MARMS 4-hydroxybenzoate octaprenyltransferase OS=Marinomonas sp. (strain MWYL1) GN=ubiA PE=3 SV=1 61 247 1.0E-10
sp|A1RFH5|UBIA_SHESW 4-hydroxybenzoate octaprenyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiA PE=3 SV=1 62 238 1.0E-10
sp|A4YAV1|UBIA_SHEPC 4-hydroxybenzoate octaprenyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiA PE=3 SV=1 62 238 1.0E-10
sp|Q02E04|UBIA_PSEAB 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiA PE=3 SV=1 57 214 1.0E-10
sp|Q5E207|UBIA_VIBF1 4-hydroxybenzoate octaprenyltransferase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=ubiA PE=3 SV=1 50 227 1.0E-10
sp|Q608Z9|UBIA_METCA 4-hydroxybenzoate octaprenyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ubiA PE=3 SV=1 57 238 1.0E-10
sp|A4Y0P0|UBIA_PSEMY 4-hydroxybenzoate octaprenyltransferase OS=Pseudomonas mendocina (strain ymp) GN=ubiA PE=3 SV=1 57 214 2.0E-10
sp|Q7VL38|UBIA_HAEDU 4-hydroxybenzoate octaprenyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiA PE=3 SV=1 60 214 2.0E-10
sp|B0TRE7|UBIA_SHEHH 4-hydroxybenzoate octaprenyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiA PE=3 SV=1 62 238 2.0E-10
sp|Q8EJJ5|UBIA_SHEON 4-hydroxybenzoate octaprenyltransferase OS=Shewanella oneidensis (strain MR-1) GN=ubiA PE=3 SV=1 62 238 2.0E-10
sp|Q55500|PLQA_SYNY3 4-hydroxybenzoate solanesyltransferase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=plqA PE=1 SV=1 60 288 2.0E-10
sp|Q0HQR8|UBIA_SHESR 4-hydroxybenzoate octaprenyltransferase OS=Shewanella sp. (strain MR-7) GN=ubiA PE=3 SV=1 62 238 2.0E-10
sp|Q0HN13|UBIA_SHESM 4-hydroxybenzoate octaprenyltransferase OS=Shewanella sp. (strain MR-4) GN=ubiA PE=3 SV=1 62 238 2.0E-10
sp|Q4FR08|UBIA_PSYA2 4-hydroxybenzoate octaprenyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiA PE=3 SV=1 53 222 2.0E-10
sp|A1WKC0|UBIA_VEREI 4-hydroxybenzoate octaprenyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=ubiA PE=3 SV=1 61 251 3.0E-10
sp|Q0I0W3|UBIA_HAES1 4-hydroxybenzoate octaprenyltransferase OS=Haemophilus somnus (strain 129Pt) GN=ubiA PE=3 SV=1 53 252 3.0E-10
sp|C1DK47|UBIA_AZOVD 4-hydroxybenzoate octaprenyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiA PE=3 SV=1 57 221 4.0E-10
sp|B0UUY3|UBIA_HISS2 4-hydroxybenzoate octaprenyltransferase OS=Histophilus somni (strain 2336) GN=ubiA PE=3 SV=1 54 252 4.0E-10
sp|Q93YP7|COQ2_ARATH 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Arabidopsis thaliana GN=PPT1 PE=2 SV=1 37 214 5.0E-10
sp|Q2SNV5|UBIA_HAHCH 4-hydroxybenzoate octaprenyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiA PE=3 SV=1 57 214 5.0E-10
sp|B1KKU2|UBIA_SHEWM 4-hydroxybenzoate octaprenyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiA PE=3 SV=1 62 237 6.0E-10
sp|A8GZR0|UBIA_SHEPA 4-hydroxybenzoate octaprenyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiA PE=3 SV=1 62 227 6.0E-10
sp|A1K2P1|UBIA_AZOSB 4-hydroxybenzoate octaprenyltransferase OS=Azoarcus sp. (strain BH72) GN=ubiA PE=3 SV=1 53 243 8.0E-10
sp|A1T087|UBIA_PSYIN 4-hydroxybenzoate octaprenyltransferase OS=Psychromonas ingrahamii (strain 37) GN=ubiA PE=3 SV=1 56 214 9.0E-10
sp|A1U6P5|UBIA_MARHV 4-hydroxybenzoate octaprenyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiA PE=3 SV=1 53 236 1.0E-09
sp|Q21DY7|UBIA_SACD2 4-hydroxybenzoate octaprenyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=ubiA PE=3 SV=1 57 214 1.0E-09
sp|A8AN88|UBIA_CITK8 4-hydroxybenzoate octaprenyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ubiA PE=3 SV=1 52 238 1.0E-09
sp|C6DKC9|UBIA_PECCP 4-hydroxybenzoate octaprenyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ubiA PE=3 SV=1 52 285 1.0E-09
sp|Q5F9S8|UBIA_NEIG1 4-hydroxybenzoate octaprenyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=ubiA PE=3 SV=1 53 237 2.0E-09
sp|Q47J11|UBIA_DECAR 4-hydroxybenzoate octaprenyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiA PE=3 SV=1 61 243 2.0E-09
sp|Q1Q996|UBIA_PSYCK 4-hydroxybenzoate octaprenyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiA PE=3 SV=1 53 214 3.0E-09
sp|Q3BYM7|UBIA_XANC5 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiA PE=3 SV=1 48 297 3.0E-09
sp|A4JBP9|UBIA_BURVG 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiA PE=3 SV=1 61 289 3.0E-09
sp|A0KEP9|UBIA_AERHH 4-hydroxybenzoate octaprenyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ubiA PE=3 SV=1 53 300 3.0E-09
sp|A3QIF2|UBIA_SHELP 4-hydroxybenzoate octaprenyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiA PE=3 SV=1 62 227 4.0E-09
sp|Q9JV93|UBIA_NEIMA 4-hydroxybenzoate octaprenyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiA PE=3 SV=1 53 237 5.0E-09
sp|B8CTT5|UBIA_SHEPW 4-hydroxybenzoate octaprenyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiA PE=3 SV=1 62 238 5.0E-09
sp|B6ENU2|UBIA_ALISL 4-hydroxybenzoate octaprenyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=ubiA PE=3 SV=1 50 221 5.0E-09
sp|Q8I7J4|COQ2_CAEEL 4-hydroxybenzoate polyprenyltransferase, mitochondrial OS=Caenorhabditis elegans GN=coq-2 PE=3 SV=2 53 302 5.0E-09
sp|B2K1U4|UBIA_YERPB 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiA PE=3 SV=1 53 222 6.0E-09
sp|Q8PDE8|UBIA_XANCP 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiA PE=3 SV=1 61 299 6.0E-09
sp|B0RMR4|UBIA_XANCB 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiA PE=3 SV=1 61 299 6.0E-09
sp|Q4UZN6|UBIA_XANC8 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiA PE=3 SV=1 61 299 6.0E-09
sp|A1S2M4|UBIA_SHEAM 4-hydroxybenzoate octaprenyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiA PE=3 SV=1 62 238 7.0E-09
sp|B1JNE6|UBIA_YERPY 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|Q66FH0|UBIA_YERPS 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|A4TRU8|UBIA_YERPP 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pestis (strain Pestoides F) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|Q1CE95|UBIA_YERPN 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|A9QYL1|UBIA_YERPG 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|Q7CKP5|UBIA_YERPE 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pestis GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|Q1C0T8|UBIA_YERPA 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiA PE=3 SV=1 53 222 7.0E-09
sp|A9L4Q8|UBIA_SHEB9 4-hydroxybenzoate octaprenyltransferase OS=Shewanella baltica (strain OS195) GN=ubiA PE=3 SV=1 62 227 7.0E-09
sp|B8E613|UBIA_SHEB2 4-hydroxybenzoate octaprenyltransferase OS=Shewanella baltica (strain OS223) GN=ubiA PE=3 SV=1 62 227 7.0E-09
sp|A6WT76|UBIA_SHEB8 4-hydroxybenzoate octaprenyltransferase OS=Shewanella baltica (strain OS185) GN=ubiA PE=3 SV=1 62 227 8.0E-09
sp|A3CZR1|UBIA_SHEB5 4-hydroxybenzoate octaprenyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiA PE=3 SV=1 62 227 8.0E-09
sp|B1XRV6|UBIA_POLNS 4-hydroxybenzoate octaprenyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=ubiA PE=3 SV=1 50 262 8.0E-09
sp|A7FN99|UBIA_YERP3 4-hydroxybenzoate octaprenyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiA PE=3 SV=1 53 222 8.0E-09
sp|Q0AGZ9|UBIA_NITEC 4-hydroxybenzoate octaprenyltransferase OS=Nitrosomonas eutropha (strain C91) GN=ubiA PE=3 SV=1 61 237 8.0E-09
sp|B4RK00|UBIA_NEIG2 4-hydroxybenzoate octaprenyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=ubiA PE=3 SV=1 53 237 1.0E-08
sp|Q8PQD5|UBIA_XANAC 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiA PE=3 SV=1 61 297 1.0E-08
sp|A3NDA6|UBIA_BURP6 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia pseudomallei (strain 668) GN=ubiA PE=3 SV=1 61 237 1.0E-08
sp|A3NZ16|UBIA_BURP0 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=ubiA PE=3 SV=1 61 237 1.0E-08
sp|C3LPT6|UBIA_VIBCM 4-hydroxybenzoate octaprenyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiA PE=3 SV=1 61 221 1.0E-08
sp|Q9KVP7|UBIA_VIBCH 4-hydroxybenzoate octaprenyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiA PE=3 SV=1 61 221 1.0E-08
sp|A5F4H4|UBIA_VIBC3 4-hydroxybenzoate octaprenyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiA PE=3 SV=1 61 221 1.0E-08
sp|Q63R13|UBIA_BURPS 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=ubiA PE=3 SV=2 61 237 1.0E-08
sp|Q3JNX1|UBIA_BURP1 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=ubiA PE=3 SV=2 61 237 1.0E-08
sp|Q62H69|UBIA_BURMA 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=ubiA PE=3 SV=2 61 237 1.0E-08
sp|A3MPC2|UBIA_BURM7 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia mallei (strain NCTC 10247) GN=ubiA PE=3 SV=1 61 237 1.0E-08
sp|Q9K083|UBIA_NEIMB 4-hydroxybenzoate octaprenyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiA PE=3 SV=1 53 237 1.0E-08
sp|Q0VTA7|UBIA_ALCBS 4-hydroxybenzoate octaprenyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=ubiA PE=3 SV=1 52 249 1.0E-08
sp|A5CXV6|UBIA_VESOH 4-hydroxybenzoate octaprenyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=ubiA PE=3 SV=2 57 214 1.0E-08
sp|A4SZT5|UBIA_POLSQ 4-hydroxybenzoate octaprenyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=ubiA PE=3 SV=1 47 274 2.0E-08
sp|Q82TP2|UBIA_NITEU 4-hydroxybenzoate octaprenyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiA PE=3 SV=2 61 237 2.0E-08
sp|Q0SXQ7|UBIA_SHIF8 4-hydroxybenzoate octaprenyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=ubiA PE=3 SV=1 51 286 2.0E-08
sp|B6I5Q5|UBIA_ECOSE 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain SE11) GN=ubiA PE=3 SV=1 51 286 2.0E-08
sp|A8A7E0|UBIA_ECOHS 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=ubiA PE=3 SV=1 51 286 2.0E-08
sp|B7M7V3|UBIA_ECO8A 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O8 (strain IAI1) GN=ubiA PE=3 SV=1 51 286 2.0E-08
sp|B7LAY8|UBIA_ECO55 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=ubiA PE=3 SV=1 51 286 2.0E-08
sp|Q83IP7|UBIA_SHIFL 4-hydroxybenzoate octaprenyltransferase OS=Shigella flexneri GN=ubiA PE=3 SV=1 52 286 2.0E-08
sp|A1KSZ7|UBIA_NEIMF 4-hydroxybenzoate octaprenyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=ubiA PE=3 SV=1 53 237 2.0E-08
sp|A9M390|UBIA_NEIM0 4-hydroxybenzoate octaprenyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiA PE=3 SV=1 53 237 2.0E-08
sp|A1JRU3|UBIA_YERE8 4-hydroxybenzoate octaprenyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiA PE=3 SV=1 50 238 3.0E-08
sp|A4STB5|UBIA_AERS4 4-hydroxybenzoate octaprenyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiA PE=3 SV=2 53 301 3.0E-08
sp|A1W307|UBIA_ACISJ 4-hydroxybenzoate octaprenyltransferase OS=Acidovorax sp. (strain JS42) GN=ubiA PE=3 SV=1 52 261 3.0E-08
sp|B9MBT5|UBIA_ACIET 4-hydroxybenzoate octaprenyltransferase OS=Acidovorax ebreus (strain TPSY) GN=ubiA PE=3 SV=1 52 261 3.0E-08
sp|Q0A5V9|UBIA_ALKEH 4-hydroxybenzoate octaprenyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiA PE=3 SV=1 60 240 3.0E-08
sp|Q3YUU4|UBIA_SHISS 4-hydroxybenzoate octaprenyltransferase OS=Shigella sonnei (strain Ss046) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|Q327U7|UBIA_SHIDS 4-hydroxybenzoate octaprenyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|Q31TU8|UBIA_SHIBS 4-hydroxybenzoate octaprenyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B2TX76|UBIA_SHIB3 4-hydroxybenzoate octaprenyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B1LPK5|UBIA_ECOSM 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B7NFY4|UBIA_ECOLU 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|P0AGK1|UBIA_ECOLI 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain K12) GN=ubiA PE=1 SV=1 51 286 4.0E-08
sp|B1IUL2|UBIA_ECOLC 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|P0AGK2|UBIA_ECOL6 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|Q0TA22|UBIA_ECOL5 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B1XC39|UBIA_ECODH 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|C5A133|UBIA_ECOBW 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B7MRH2|UBIA_ECO81 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O81 (strain ED1a) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B7NS04|UBIA_ECO7I 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B5Z181|UBIA_ECO5E 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|P0AGK3|UBIA_ECO57 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O157:H7 GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|B7UPK1|UBIA_ECO27 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|A7ZUR2|UBIA_ECO24 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ubiA PE=3 SV=1 51 286 4.0E-08
sp|Q31DM4|UBIA_THICR 4-hydroxybenzoate octaprenyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiA PE=3 SV=1 53 214 4.0E-08
sp|Q5NGI4|UBIA_FRATT 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=ubiA PE=3 SV=1 61 214 5.0E-08
sp|Q14HY6|UBIA_FRAT1 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=ubiA PE=3 SV=1 61 214 5.0E-08
sp|Q5H5R3|UBIA_XANOR 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiA PE=3 SV=1 61 294 6.0E-08
sp|B2SS70|UBIA_XANOP 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiA PE=3 SV=1 61 294 6.0E-08
sp|Q2P8F5|UBIA_XANOM 4-hydroxybenzoate octaprenyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiA PE=3 SV=1 61 294 6.0E-08
sp|Q1R3P6|UBIA_ECOUT 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=ubiA PE=3 SV=1 52 286 6.0E-08
sp|A1AIL7|UBIA_ECOK1 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O1:K1 / APEC GN=ubiA PE=3 SV=1 52 286 6.0E-08
sp|B7MJ30|UBIA_ECO45 4-hydroxybenzoate octaprenyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ubiA PE=3 SV=1 52 286 6.0E-08
sp|A7N9N4|CYOE_FRATF Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=cyoE PE=3 SV=1 41 220 6.0E-08
sp|A4IZX0|CYOE_FRATW Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=cyoE PE=3 SV=1 41 220 7.0E-08
sp|Q0BNW5|CYOE_FRATO Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=cyoE PE=3 SV=1 41 220 7.0E-08
sp|A0Q4E4|CYOE_FRATN Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=cyoE PE=3 SV=1 41 220 7.0E-08
sp|Q2A5L1|CYOE_FRATH Protoheme IX farnesyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=cyoE PE=3 SV=1 41 220 9.0E-08
sp|Q39JF0|UBIA_BURL3 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=ubiA PE=3 SV=1 61 289 1.0E-07
sp|Q2SZ16|UBIA_BURTA 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=ubiA PE=3 SV=2 57 237 1.0E-07
sp|A0K4Q5|UBIA_BURCH 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=ubiA PE=3 SV=1 61 289 1.0E-07
sp|Q1BYZ6|UBIA_BURCA 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=ubiA PE=3 SV=1 61 289 1.0E-07
sp|B2SF41|UBIA_FRATM 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=ubiA PE=3 SV=1 61 214 2.0E-07
sp|Q2A564|UBIA_FRATH 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=ubiA PE=3 SV=1 61 214 2.0E-07
sp|A4IYU3|UBIA_FRATW 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=ubiA PE=3 SV=1 61 214 2.0E-07
sp|A7NA50|UBIA_FRATF 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=ubiA PE=3 SV=1 61 214 2.0E-07
sp|Q5ZVL0|UBIA_LEGPH 4-hydroxybenzoate octaprenyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ubiA PE=3 SV=1 60 214 2.0E-07
sp|A0Q4X3|UBIA_FRATN 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=ubiA PE=3 SV=1 61 214 2.0E-07
sp|Q07XN2|UBIA_SHEFN 4-hydroxybenzoate octaprenyltransferase OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiA PE=3 SV=1 62 227 2.0E-07
sp|Q7VQU0|UBIA_BLOFL 4-hydroxybenzoate octaprenyltransferase OS=Blochmannia floridanus GN=ubiA PE=3 SV=1 60 214 2.0E-07
sp|Q5QUP3|UBIA_IDILO 4-hydroxybenzoate octaprenyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiA PE=3 SV=1 40 221 2.0E-07
sp|A7MPP0|UBIA_CROS8 4-hydroxybenzoate octaprenyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ubiA PE=3 SV=1 37 238 3.0E-07
sp|Q1LJ64|UBIA_CUPMC 4-hydroxybenzoate octaprenyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ubiA PE=3 SV=1 52 243 3.0E-07
sp|Q6LVS3|UBIA_PHOPR 4-hydroxybenzoate octaprenyltransferase OS=Photobacterium profundum GN=ubiA PE=3 SV=1 60 244 4.0E-07
sp|A5IBS2|UBIA_LEGPC 4-hydroxybenzoate octaprenyltransferase OS=Legionella pneumophila (strain Corby) GN=ubiA PE=3 SV=1 60 214 4.0E-07
sp|Q2NR07|UBIA_SODGM 4-hydroxybenzoate octaprenyltransferase OS=Sodalis glossinidius (strain morsitans) GN=ubiA PE=3 SV=1 53 221 4.0E-07
sp|Q0BNI0|UBIA_FRATO 4-hydroxybenzoate octaprenyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=ubiA PE=3 SV=1 61 214 5.0E-07
sp|B1JVZ5|UBIA_BURCC 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiA PE=3 SV=1 61 289 5.0E-07
sp|Q8XVY9|UBIA_RALSO 4-hydroxybenzoate octaprenyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=ubiA PE=3 SV=1 53 237 5.0E-07
sp|C4L7X6|UBIA_TOLAT 4-hydroxybenzoate octaprenyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ubiA PE=3 SV=1 50 224 5.0E-07
sp|A8GKB7|UBIA_SERP5 4-hydroxybenzoate octaprenyltransferase OS=Serratia proteamaculans (strain 568) GN=ubiA PE=3 SV=2 61 251 7.0E-07
sp|Q5X5D5|UBIA_LEGPA 4-hydroxybenzoate octaprenyltransferase OS=Legionella pneumophila (strain Paris) GN=ubiA PE=3 SV=1 60 214 7.0E-07
sp|A9AGE2|UBIA_BURM1 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=ubiA PE=3 SV=1 61 221 9.0E-07
sp|B1YTH7|UBIA_BURA4 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=ubiA PE=3 SV=1 61 289 1.0E-06
sp|Q0BI45|UBIA_BURCM 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=ubiA PE=3 SV=1 61 289 1.0E-06
sp|Q1QSG2|UBIA_CHRSD 4-hydroxybenzoate octaprenyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=ubiA PE=3 SV=1 46 256 1.0E-06
sp|Q46XG9|UBIA_CUPPJ 4-hydroxybenzoate octaprenyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ubiA PE=3 SV=1 52 262 1.0E-06
sp|Q12S01|UBIA_SHEDO 4-hydroxybenzoate octaprenyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiA PE=3 SV=2 62 286 2.0E-06
sp|Q5WWR8|UBIA_LEGPL 4-hydroxybenzoate octaprenyltransferase OS=Legionella pneumophila (strain Lens) GN=ubiA PE=3 SV=1 60 214 2.0E-06
sp|A1WVM9|UBIA_HALHL 4-hydroxybenzoate octaprenyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=ubiA PE=3 SV=2 61 214 2.0E-06
sp|Q3SLJ4|UBIA_THIDA 4-hydroxybenzoate octaprenyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=ubiA PE=3 SV=1 57 221 2.0E-06
sp|Q1GXB3|UBIA_METFK 4-hydroxybenzoate octaprenyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=ubiA PE=3 SV=1 57 283 2.0E-06
sp|A4W5F3|UBIA_ENT38 4-hydroxybenzoate octaprenyltransferase OS=Enterobacter sp. (strain 638) GN=ubiA PE=3 SV=1 52 286 2.0E-06
sp|Q6F9N8|UBIA_ACIAD 4-hydroxybenzoate octaprenyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiA PE=3 SV=2 43 214 2.0E-06
sp|Q8K997|CYOE_BUCAP Protoheme IX farnesyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cyoE PE=3 SV=1 57 212 3.0E-06
sp|B2JGG3|UBIA_BURP8 4-hydroxybenzoate octaprenyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ubiA PE=3 SV=1 61 245 4.0E-06
sp|Q83SF7|CYOE_SHIFL Protoheme IX farnesyltransferase OS=Shigella flexneri GN=cyoE PE=3 SV=5 21 173 4.0E-06
sp|Q2Y5S3|UBIA_NITMU 4-hydroxybenzoate octaprenyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiA PE=3 SV=1 61 221 4.0E-06
sp|A8AK26|CYOE_CITK8 Protoheme IX farnesyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cyoE PE=3 SV=1 21 173 4.0E-06
sp|A1TJR2|UBIA_ACIAC 4-hydroxybenzoate octaprenyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiA PE=3 SV=1 61 222 8.0E-06
sp|B9JAP1|COXX_AGRRK Protoheme IX farnesyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=ctaB PE=3 SV=1 24 223 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 43 65 22
2 85 107 22
3 119 136 17
4 146 168 22
5 173 195 22
6 218 240 22
7 247 269 22
8 284 301 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1464
MPTTKRHLTRHLLTLSRFNKYNPLFTTFAGDLASQRPTVTPPFVLRQTGLCFVAAYLFCGAGMVWNDWVDRDIDA
NVSRTKDRPLAAGVVTTAEAMAWMLLQLSLSWLVLDLMLDGKDVWKHMLPIIIASFLYPFGKRPLARTLYIYPQY
ILAFVIAWPAVPGRAAISGRYDAFSHTIYHCLPICTTVFFWTLYLNTAYSYQDIVDDRKLNVNSLYNVAGRHTHG
LLVALVSPILLCLPLHLAQFRSPWLWISWMGVWTAALVTQLLRFDPKRPASGGTLHKSNFVLGVWTLVACVVELL
LKT*
Coding >Ophun1|1464
ATGCCAACAACAAAGAGACACTTAACGCGCCACCTCCTCACCCTATCGCGCTTCAACAAGTACAACCCTCTCTTT
ACAACTTTCGCCGGAGACCTGGCCTCTCAACGGCCGACGGTCACGCCTCCCTTCGTTCTCAGACAGACGGGTCTC
TGCTTTGTAGCGGCCTACCTGTTCTGCGGCGCTGGCATGGTGTGGAACGATTGGGTTGATCGCGATATCGATGCC
AATGTTTCTCGGACCAAGGATCGGCCGCTGGCTGCGGGTGTCGTCACCACGGCTGAGGCTATGGCGTGGATGCTT
CTTCAGCTCTCGCTGTCGTGGCTGGTGCTTGATCTTATGCTCGACGGCAAAGACGTGTGGAAGCACATGCTGCCC
ATCATCATAGCCTCGTTCCTCTACCCCTTCGGAAAGAGACCGCTGGCCAGGACGCTCTACATCTACCCGCAGTAC
ATCCTGGCCTTCGTCATTGCCTGGCCTGCCGTCCCCGGAAGAGCCGCCATCTCAGGCCGCTACGATGCCTTCTCC
CACACGATATACCACTGCCTCCCCATCTGCACCACCGTCTTCTTCTGGACGCTGTACCTCAACACAGCCTACAGC
TACCAAGACATCGTCGACGACCGGAAGCTCAACGTCAACTCACTGTACAACGTCGCCGGACGCCACACGCACGGC
TTGCTGGTTGCCCTCGTCAGCCCGATCCTGCTGTGTCTGCCTCTGCACCTGGCCCAGTTTCGCTCCCCCTGGCTG
TGGATCAGCTGGATGGGCGTCTGGACCGCGGCTCTGGTGACGCAGTTGCTGCGATTCGATCCCAAGAGGCCTGCG
AGCGGAGGGACGCTGCATAAGAGCAACTTTGTTCTTGGTGTCTGGACTCTTGTTGCGTGTGTAGTCGAGCTGTTG
TTGAAGACTTGA
Transcript >Ophun1|1464
ATGCCAACAACAAAGAGACACTTAACGCGCCACCTCCTCACCCTATCGCGCTTCAACAAGTACAACCCTCTCTTT
ACAACTTTCGCCGGAGACCTGGCCTCTCAACGGCCGACGGTCACGCCTCCCTTCGTTCTCAGACAGACGGGTCTC
TGCTTTGTAGCGGCCTACCTGTTCTGCGGCGCTGGCATGGTGTGGAACGATTGGGTTGATCGCGATATCGATGCC
AATGTTTCTCGGACCAAGGATCGGCCGCTGGCTGCGGGTGTCGTCACCACGGCTGAGGCTATGGCGTGGATGCTT
CTTCAGCTCTCGCTGTCGTGGCTGGTGCTTGATCTTATGCTCGACGGCAAAGACGTGTGGAAGCACATGCTGCCC
ATCATCATAGCCTCGTTCCTCTACCCCTTCGGAAAGAGACCGCTGGCCAGGACGCTCTACATCTACCCGCAGTAC
ATCCTGGCCTTCGTCATTGCCTGGCCTGCCGTCCCCGGAAGAGCCGCCATCTCAGGCCGCTACGATGCCTTCTCC
CACACGATATACCACTGCCTCCCCATCTGCACCACCGTCTTCTTCTGGACGCTGTACCTCAACACAGCCTACAGC
TACCAAGACATCGTCGACGACCGGAAGCTCAACGTCAACTCACTGTACAACGTCGCCGGACGCCACACGCACGGC
TTGCTGGTTGCCCTCGTCAGCCCGATCCTGCTGTGTCTGCCTCTGCACCTGGCCCAGTTTCGCTCCCCCTGGCTG
TGGATCAGCTGGATGGGCGTCTGGACCGCGGCTCTGGTGACGCAGTTGCTGCGATTCGATCCCAAGAGGCCTGCG
AGCGGAGGGACGCTGCATAAGAGCAACTTTGTTCTTGGTGTCTGGACTCTTGTTGCGTGTGTAGTCGAGCTGTTG
TTGAAGACTTGA
Gene >Ophun1|1464
ATGCCAACAACAAAGAGACACTTAACGCGCCACCTCCTCACCCTATCGCGCTTCAACAAGTACAACCCTCTCTTT
ACAACTTTCGCCGGAGGTACGTGAGCTCACAGTCAGCCCATCCTACCAAACTCACCGACAAGCACAAAGCATGGT
CCGCGCTACTAGCCGGAGCGGCAGACCTGGCCTCTCAACGGCCGACGGTCACGCCTCCCTTCGTTCTCAGACAGA
CGGGTCTCTGCTTTGTAGCGGCCTACCTGTTCTGCGGCGCTGGCATGGTGTGGAACGATTGGGTTGATCGCGATA
TCGATGCCAATGTTTCTCGGACCAAGGATCGGCCGCTGGCTGCGGGTGTCGTCACCACGGCTGAGGCTATGGCGT
GGATGCTTCTTCAGCTCTCGCTGTCGTGGCTGGTGCTTGATCTTATGCTCGACGGCAAAGACGTGTAAGTCTCGT
GTTAAGTTAGACGTCTTGTCAACCTCTCACGCTCGCACAGGTGGAAGCACATGCTGCCCATCATCATAGCCTCGT
TCCTCTACCCCTTCGGAAAGAGACCGCTGGCCAGGACGCTCTACATCTACCCGCAGTACATCCTGGCCTTCGTCA
TTGCCTGGCCTGCCGTCCCCGGAAGAGCCGCCATCTCAGGCCGCTACGATGCCTTCTCCCACACGATATACCACT
GCCTCCCCATCTGCACCACCGTCTTCTTCTGGACGCTGTACCTCAACACAGCCTACAGCTACCAAGACATCGTCG
ACGACCGGAAGCTCAACGTCAACTCACTGTACAACGTCGCCGGACGCCACACGCACGGCTTGCTGGTTGCCCTCG
TCAGCCCGATCCTGCTGTGTCTGCCTCTGCACCTGGCCCAGTTTCGCTCCCCCTGGCTGTGGATCAGCTGGATGG
GCGTCTGGACCGCGGCTCTGGTGACGCAGTTGCTGCGATTCGATCCCAAGAGGCCTGCGAGCGGAGGGACGCTGC
ATAAGAGCAACTTTGTTCTTGGTGTCTGGACTCTTGTTGCGTGTGTAGTCGAGCTGTTGTTGAAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail