Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1449
Gene name
LocationContig_159:23203..26105
Strand+
Gene length (bp)2902
Transcript length (bp)2742
Coding sequence length (bp)2742
Protein length (aa) 914

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00613 PI3Ka Phosphoinositide 3-kinase family, accessory domain (PIK domain) 7.7E-58 363 536
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 1.2E-41 655 858
PF00792 PI3K_C2 Phosphoinositide 3-kinase C2 1.4E-32 58 221

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 5 912 0.0E+00
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 5 912 0.0E+00
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 62 913 0.0E+00
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 8 912 0.0E+00
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 7 913 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6AZN6|PK3C3_XENLA Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Xenopus laevis GN=pik3c3 PE=2 SV=1 5 912 0.0E+00
sp|Q6PF93|PK3C3_MOUSE Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Mus musculus GN=Pik3c3 PE=1 SV=1 5 912 0.0E+00
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 62 913 0.0E+00
sp|P42339|PI3K_ARATH Phosphatidylinositol 3-kinase VPS34 OS=Arabidopsis thaliana GN=At1g60490 PE=2 SV=2 8 912 0.0E+00
sp|P22543|VPS34_YEAST Phosphatidylinositol 3-kinase VPS34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS34 PE=1 SV=1 7 913 0.0E+00
sp|P42347|PI3K1_SOYBN Phosphatidylinositol 3-kinase, root isoform OS=Glycine max PE=2 SV=1 8 912 0.0E+00
sp|Q5D891|PK3C3_PIG Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Sus scrofa GN=PIK3C3 PE=2 SV=1 5 912 0.0E+00
sp|Q8NEB9|PK3C3_HUMAN Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Homo sapiens GN=PIK3C3 PE=1 SV=1 5 912 0.0E+00
sp|O88763|PK3C3_RAT Phosphatidylinositol 3-kinase catalytic subunit type 3 OS=Rattus norvegicus GN=Pik3c3 PE=1 SV=1 5 912 0.0E+00
sp|P42348|PI3K2_SOYBN Phosphatidylinositol 3-kinase, nodule isoform OS=Glycine max PE=2 SV=1 8 912 0.0E+00
sp|P54676|PI3K4_DICDI Phosphatidylinositol 3-kinase VPS34-like OS=Dictyostelium discoideum GN=pikE PE=3 SV=2 10 913 9.0E-178
sp|Q92213|VPS34_CANAX Phosphatidylinositol 3-kinase VPS34 OS=Candida albicans GN=VPS34 PE=3 SV=1 11 913 4.0E-175
sp|P54675|PI3K3_DICDI Phosphatidylinositol 3-kinase 3 OS=Dictyostelium discoideum GN=pikC PE=2 SV=2 373 895 1.0E-74
sp|O35904|PK3CD_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Mus musculus GN=Pik3cd PE=1 SV=2 327 885 5.0E-74
sp|O00329|PK3CD_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform OS=Homo sapiens GN=PIK3CD PE=1 SV=2 387 885 3.0E-73
sp|P54673|PI3K1_DICDI Phosphatidylinositol 3-kinase 1 OS=Dictyostelium discoideum GN=pikA PE=2 SV=2 370 910 7.0E-72
sp|O02697|PK3CG_PIG Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Sus scrofa GN=PIK3CG PE=1 SV=2 367 890 1.0E-68
sp|P48736|PK3CG_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Homo sapiens GN=PIK3CG PE=1 SV=3 367 890 2.0E-68
sp|Q9JHG7|PK3CG_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform OS=Mus musculus GN=Pik3cg PE=1 SV=2 367 890 2.0E-67
sp|P54674|PI3K2_DICDI Phosphatidylinositol 3-kinase 2 OS=Dictyostelium discoideum GN=pikB PE=2 SV=2 375 909 1.0E-66
sp|O00443|P3C2A_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Homo sapiens GN=PIK3C2A PE=1 SV=2 387 909 7.0E-64
sp|P32871|PK3CA_BOVIN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Bos taurus GN=PIK3CA PE=1 SV=1 362 885 1.0E-63
sp|P42336|PK3CA_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Homo sapiens GN=PIK3CA PE=1 SV=2 362 885 2.0E-63
sp|Q5RAY1|P3C2A_PONAB Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Pongo abelii GN=PIK3C2A PE=2 SV=1 387 909 2.0E-63
sp|P42337|PK3CA_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform OS=Mus musculus GN=Pik3ca PE=1 SV=2 362 885 7.0E-63
sp|Q61194|P3C2A_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha OS=Mus musculus GN=Pik3c2a PE=1 SV=2 387 909 1.0E-62
sp|Q9Z1L0|PK3CB_RAT Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Rattus norvegicus GN=Pik3cb PE=2 SV=1 375 893 1.0E-62
sp|Q8BTI9|PK3CB_MOUSE Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Mus musculus GN=Pik3cb PE=1 SV=2 375 893 3.0E-62
sp|P42338|PK3CB_HUMAN Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform OS=Homo sapiens GN=PIK3CB PE=1 SV=1 375 893 2.0E-61
sp|O00750|P3C2B_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens GN=PIK3C2B PE=1 SV=2 374 909 1.0E-58
sp|O70173|P3C2G_RAT Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Rattus norvegicus GN=Pik3c2g PE=2 SV=1 383 909 7.0E-57
sp|O70167|P3C2G_MOUSE Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Mus musculus GN=Pik3c2g PE=2 SV=1 386 909 1.0E-56
sp|O75747|P3C2G_HUMAN Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit gamma OS=Homo sapiens GN=PIK3C2G PE=1 SV=3 386 909 1.0E-54
sp|Q94125|AGE1_CAEEL Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis elegans GN=age-1 PE=1 SV=6 377 890 1.0E-47
sp|P0C5E7|AGE1_CAEBR Phosphatidylinositol 3-kinase age-1 OS=Caenorhabditis briggsae GN=age-1 PE=3 SV=1 376 835 2.0E-42
sp|Q8SQY7|STT4_ENCCU Probable phosphatidylinositol 4-kinase STT4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=STT4 PE=3 SV=2 437 881 1.0E-36
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 651 911 3.0E-32
sp|Q9SXA1|P4KA1_ARATH Phosphatidylinositol 4-kinase alpha 1 OS=Arabidopsis thaliana GN=PI4KA1 PE=1 SV=2 390 889 2.0E-30
sp|Q49GP3|PI4KB_DANRE Phosphatidylinositol 4-kinase beta OS=Danio rerio GN=pi4kb PE=2 SV=2 657 902 2.0E-30
sp|A4IID4|PI4KB_XENTR Phosphatidylinositol 4-kinase beta OS=Xenopus tropicalis GN=pi4kb PE=2 SV=1 657 902 3.0E-30
sp|Q8BKC8|PI4KB_MOUSE Phosphatidylinositol 4-kinase beta OS=Mus musculus GN=Pi4kb PE=1 SV=2 657 902 6.0E-30
sp|O08561|PI4KB_RAT Phosphatidylinositol 4-kinase beta OS=Rattus norvegicus GN=Pi4kb PE=1 SV=1 657 902 7.0E-30
sp|Q9UBF8|PI4KB_HUMAN Phosphatidylinositol 4-kinase beta OS=Homo sapiens GN=PI4KB PE=1 SV=1 657 902 1.0E-29
sp|A9X1A0|PI4KB_PAPAN Phosphatidylinositol 4-kinase beta OS=Papio anubis GN=PI4KB PE=3 SV=2 657 902 1.0E-29
sp|B1MTG7|PI4KB_CALMO Phosphatidylinositol 4-kinase beta OS=Callicebus moloch GN=PI4KB PE=3 SV=1 657 902 1.0E-29
sp|B4UT09|PI4KB_OTOGA Phosphatidylinositol 4-kinase beta OS=Otolemur garnettii GN=PI4KB PE=3 SV=1 657 902 1.0E-29
sp|B0KWC1|PI4KB_CALJA Phosphatidylinositol 4-kinase beta OS=Callithrix jacchus GN=PI4KB PE=3 SV=1 657 902 1.0E-29
sp|B2KI64|PI4KB_RHIFE Phosphatidylinositol 4-kinase beta OS=Rhinolophus ferrumequinum GN=PI4KB PE=3 SV=1 657 902 1.0E-29
sp|B3EX61|PI4KB_SORAR Phosphatidylinositol 4-kinase beta OS=Sorex araneus GN=PI4KB PE=3 SV=1 657 902 2.0E-29
sp|Q6GN16|PI4KB_XENLA Phosphatidylinositol 4-kinase beta OS=Xenopus laevis GN=pi4kb PE=2 SV=1 657 902 5.0E-29
sp|O02810|PI4KB_BOVIN Phosphatidylinositol 4-kinase beta OS=Bos taurus GN=PI4KB PE=1 SV=2 657 902 8.0E-29
sp|Q5UR69|YL615_MIMIV Putative phosphatidylinositol kinase L615 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L615 PE=3 SV=1 378 847 4.0E-28
sp|Q9USR3|STT4_SCHPO Phosphatidylinositol 4-kinase stt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stt4 PE=3 SV=1 452 890 4.0E-27
sp|O08662|PI4KA_RAT Phosphatidylinositol 4-kinase alpha OS=Rattus norvegicus GN=Pi4ka PE=1 SV=1 422 893 4.0E-27
sp|Q9FMJ0|P4KB1_ARATH Phosphatidylinositol 4-kinase beta 1 OS=Arabidopsis thaliana GN=PI4KB1 PE=1 SV=1 657 881 6.0E-27
sp|P42356|PI4KA_HUMAN Phosphatidylinositol 4-kinase alpha OS=Homo sapiens GN=PI4KA PE=1 SV=3 422 893 6.0E-27
sp|O02811|PI4KA_BOVIN Phosphatidylinositol 4-kinase alpha OS=Bos taurus GN=PI4KA PE=2 SV=1 422 893 2.0E-26
sp|P37297|STT4_YEAST Phosphatidylinositol 4-kinase STT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STT4 PE=1 SV=1 408 889 2.0E-26
sp|Q0WPX9|P4KB2_ARATH Phosphatidylinositol 4-kinase beta 2 OS=Arabidopsis thaliana GN=PI4KB2 PE=2 SV=1 657 881 6.0E-26
sp|P39104|PIK1_YEAST Phosphatidylinositol 4-kinase PIK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIK1 PE=1 SV=1 657 911 3.0E-25
sp|Q8SR56|VPS34_ENCCU Probable phosphatidylinositol 3-kinase VPS34 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=VPS34 PE=3 SV=2 619 912 3.0E-23
sp|Q9C680|P4KA2_ARATH Phosphatidylinositol 4-kinase alpha 2 OS=Arabidopsis thaliana GN=PI4KA2 PE=1 SV=1 615 888 5.0E-21
sp|Q9UW20|PIK1_CANAL Phosphatidylinositol 4-kinase PIK1alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKALPHA PE=3 SV=1 657 849 3.0E-20
sp|A4QPH2|PI4P2_HUMAN Putative phosphatidylinositol 4-kinase alpha-like protein P2 OS=Homo sapiens GN=PI4KAP2 PE=5 SV=3 658 893 7.0E-20
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 657 849 2.0E-19
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 548 882 1.0E-10
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 613 851 6.0E-10
sp|Q10366|PIK1_SCHPO Phosphatidylinositol 4-kinase pik1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pik1 PE=1 SV=1 651 849 7.0E-09
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 635 851 3.0E-07
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 630 819 2.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1337
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1135
Ophiocordyceps australis map64 (Brazil) OphauB2|1068
Ophiocordyceps camponoti-floridani Ophcf2|03490
Ophiocordyceps camponoti-rufipedis Ophun1|1449 (this protein)
Ophiocordyceps kimflemingae Ophio5|2692
Ophiocordyceps subramaniannii Hirsu2|10718

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1449
MTDYGRMDPFSFAGSKDVNHPVSIRIMNLDGEEPPVKSSTLLDRPDLRHIGSNTSPFSDLYVTVQVWAGSKPLTV
PVQTAYKSFRSERKWNEWLELPITYKQLPVNARLAMTIWDLSPTGGKNAIDHAIPFGGTTLPLFDADNQVQKGRQ
KCLVHRHKHADGSDNSTTPALLAPKRTSSSRAGKAPLTDKDAEELDRMEKLFKKHEMGEIPRVDWLDQMVFRSFE
KRGLQAAQSSMKMLQRQRAVNGDDEAGAKDDGSSSPSAFLLNVELPRFDFPVVFADHEYDPPPISSLQPLSASQA
SISQRQPQVHFGPGINGLGESSEGFGARLIKVYDPEVGQRDNPAEAKHRRLFRSSHRHGILDKDLKPNAKVRDEL
NLIMSYSPTHILSPEETDLVWKFRYHLTRDKRALTKFVKSVNWNDQSEAKQAIQVLGSWTEIDVDDALELLGPSF
DNPAVRSYAVDRLRKADDAELLLYLLQLVQALKYEHISTESDHDGAQDSSLASFLIQRAAANFMLGNYLYWYLMV
ECDDHSPEQGLDNRNIYRKVAYEFMTQLVRQPDGAENRKTLLRQAELVAILSKIAGEVKVSNESIAKKVDRVKTF
LADPKNELVTLDPPLAMPLDPSVKITGVAADQVTVFKSSLNPIKITFKTTNGSAYPIIFKLGDDLRQDQLVIQII
TLMEQLLRKENLDLKLSPYKILATSTTAGASQFVQSQSLSSIVGKFKTNPALAYLRHHNPDDRQPLGVRQETLDT
YIKSCAGYCVITYILGVGDRHLDNLLLAPDGHFFHADFGFILGRDPKPFAPVMKLSKEMVECMGGVHSEHYQRFR
QYCFLAYTALRKSSNLILNLFSLMVHANIPDIRLEPDKAVIKVRERFHLELTEEEAIVYFGNVIDGTLTAFAPVV
IDKLHEWAQALRA*
Coding >Ophun1|1449
ATGACAGACTACGGGAGGATGGACCCCTTCTCATTTGCGGGGTCCAAGGACGTCAATCATCCCGTCAGCATCCGC
ATAATGAACCTGGACGGTGAAGAGCCTCCGGTTAAGTCCTCGACGCTTCTCGACCGTCCTGATCTGCGACACATC
GGCTCGAACACAAGTCCCTTCTCCGACCTCTACGTCACGGTTCAGGTCTGGGCTGGCTCGAAACCCCTGACTGTT
CCCGTGCAGACGGCTTACAAGTCGTTTCGCTCGGAGAGAAAATGGAACGAGTGGCTCGAGCTGCCCATCACCTAC
AAGCAGCTGCCGGTAAATGCCCGCTTGGCCATGACCATATGGGACTTGTCGCCGACGGGAGGCAAAAACGCCATC
GATCATGCGATTCCCTTTGGCGGCACCACATTACCCCTGTTCGACGCAGATAACCAGGTGCAAAAGGGACGTCAG
AAGTGCCTCGTGCACAGGCATAAACATGCGGACGGATCCGACAACTCCACGACACCAGCTTTGCTGGCTCCAAAA
AGGACCTCGAGCTCGAGAGCTGGCAAAGCTCCGTTGACCGATAAGGACGCTGAGGAGCTGGACAGGATGGAGAAG
CTCTTCAAGAAACACGAGATGGGCGAGATTCCGCGTGTCGATTGGTTGGATCAGATGGTCTTTCGCAGCTTTGAG
AAGCGTGGACTCCAGGCTGCCCAGTCGTCCATGAAGATGCTCCAGCGTCAGCGCGCTGTCAATGGCGATGACGAG
GCCGGTGCCAAGGACGATGGATCTTCAAGCCCGTCCGCCTTTCTTCTCAACGTCGAGCTCCCGCGGTTCGACTTT
CCCGTCGTCTTTGCAGATCATGAATACGATCCGCCGCCGATTTCGTCTCTGCAGCCTCTTTCGGCTTCGCAAGCC
AGCATTTCCCAGCGACAGCCTCAAGTTCACTTTGGTCCGGGCATCAACGGCCTAGGAGAAAGCTCCGAGGGCTTC
GGGGCGCGCCTCATCAAGGTATACGACCCCGAGGTGGGCCAACGGGACAACCCGGCCGAGGCCAAGCACAGGAGG
CTCTTCCGAAGCTCTCACAGACACGGCATCCTGGACAAAGACCTCAAGCCGAACGCAAAGGTCCGCGACGAACTG
AACCTCATCATGTCATATTCGCCTACGCACATCTTATCGCCCGAGGAGACAGACCTGGTTTGGAAGTTTCGCTAC
CATCTCACTCGTGATAAGCGGGCTTTGACCAAATTCGTCAAGTCGGTCAACTGGAATGACCAGAGTGAAGCAAAG
CAGGCGATACAGGTTCTCGGCAGTTGGACTGAGATTGACGTCGATGATGCCCTTGAGCTGCTTGGCCCTTCCTTC
GACAACCCGGCTGTCCGATCCTACGCCGTCGACCGGCTGCGAAAGGCCGACGATGCCGAGTTGCTACTGTACTTG
CTCCAGCTGGTGCAGGCGCTCAAGTACGAGCACATCTCGACCGAGTCGGACCATGACGGCGCGCAGGACTCGTCT
CTGGCCAGCTTCCTCATCCAGCGGGCGGCTGCCAATTTTATGCTCGGCAACTATCTGTACTGGTATCTCATGGTG
GAATGCGATGACCACAGCCCGGAGCAGGGCCTTGACAACCGCAACATCTACCGCAAGGTCGCCTACGAGTTTATG
ACGCAGCTCGTCCGGCAGCCGGACGGGGCGGAGAACCGGAAGACGCTGCTGCGGCAGGCCGAGCTGGTGGCTATA
CTATCCAAGATAGCGGGCGAGGTCAAGGTGTCGAACGAGTCCATCGCCAAAAAGGTTGACCGCGTCAAGACGTTT
TTGGCAGACCCAAAGAACGAGCTGGTGACGCTGGATCCGCCGCTGGCAATGCCGCTCGACCCGTCGGTCAAGATA
ACGGGCGTGGCTGCCGATCAGGTGACGGTCTTCAAGTCGTCACTCAACCCCATCAAGATCACCTTCAAGACGACA
AACGGCAGCGCCTATCCCATCATCTTCAAGCTCGGCGATGACCTGCGCCAGGACCAGTTGGTGATTCAGATCATC
ACGCTCATGGAGCAGCTGCTGCGCAAGGAGAACTTGGATCTGAAGCTGTCACCGTACAAGATCCTGGCAACGAGC
ACGACGGCGGGCGCTTCGCAGTTTGTGCAGTCCCAGAGCCTGTCTAGCATCGTGGGCAAGTTCAAGACGAACCCG
GCGCTGGCTTACCTGCGGCATCACAACCCGGACGACAGGCAGCCGCTCGGGGTTCGTCAGGAGACGCTCGACACG
TACATCAAGTCGTGTGCCGGCTACTGCGTCATCACCTACATCCTCGGCGTCGGCGACCGTCATCTCGATAACCTG
CTTCTCGCGCCGGACGGTCACTTCTTCCATGCCGATTTCGGCTTCATTCTCGGTAGAGACCCCAAGCCGTTTGCG
CCGGTCATGAAGCTGTCCAAGGAGATGGTCGAGTGTATGGGCGGCGTCCACTCGGAGCACTACCAGCGCTTCCGC
CAGTACTGCTTCCTCGCCTACACGGCGCTGCGCAAGTCGTCGAACCTGATACTCAACCTGTTCAGTCTCATGGTC
CACGCGAATATCCCGGACATTCGACTCGAGCCGGACAAGGCCGTCATCAAGGTCCGGGAGCGCTTCCACCTCGAG
CTCACGGAGGAGGAAGCCATTGTCTACTTTGGCAACGTCATTGATGGCACGCTGACGGCGTTTGCGCCCGTTGTC
ATCGACAAGCTGCACGAGTGGGCGCAGGCGTTGCGGGCTTAG
Transcript >Ophun1|1449
ATGACAGACTACGGGAGGATGGACCCCTTCTCATTTGCGGGGTCCAAGGACGTCAATCATCCCGTCAGCATCCGC
ATAATGAACCTGGACGGTGAAGAGCCTCCGGTTAAGTCCTCGACGCTTCTCGACCGTCCTGATCTGCGACACATC
GGCTCGAACACAAGTCCCTTCTCCGACCTCTACGTCACGGTTCAGGTCTGGGCTGGCTCGAAACCCCTGACTGTT
CCCGTGCAGACGGCTTACAAGTCGTTTCGCTCGGAGAGAAAATGGAACGAGTGGCTCGAGCTGCCCATCACCTAC
AAGCAGCTGCCGGTAAATGCCCGCTTGGCCATGACCATATGGGACTTGTCGCCGACGGGAGGCAAAAACGCCATC
GATCATGCGATTCCCTTTGGCGGCACCACATTACCCCTGTTCGACGCAGATAACCAGGTGCAAAAGGGACGTCAG
AAGTGCCTCGTGCACAGGCATAAACATGCGGACGGATCCGACAACTCCACGACACCAGCTTTGCTGGCTCCAAAA
AGGACCTCGAGCTCGAGAGCTGGCAAAGCTCCGTTGACCGATAAGGACGCTGAGGAGCTGGACAGGATGGAGAAG
CTCTTCAAGAAACACGAGATGGGCGAGATTCCGCGTGTCGATTGGTTGGATCAGATGGTCTTTCGCAGCTTTGAG
AAGCGTGGACTCCAGGCTGCCCAGTCGTCCATGAAGATGCTCCAGCGTCAGCGCGCTGTCAATGGCGATGACGAG
GCCGGTGCCAAGGACGATGGATCTTCAAGCCCGTCCGCCTTTCTTCTCAACGTCGAGCTCCCGCGGTTCGACTTT
CCCGTCGTCTTTGCAGATCATGAATACGATCCGCCGCCGATTTCGTCTCTGCAGCCTCTTTCGGCTTCGCAAGCC
AGCATTTCCCAGCGACAGCCTCAAGTTCACTTTGGTCCGGGCATCAACGGCCTAGGAGAAAGCTCCGAGGGCTTC
GGGGCGCGCCTCATCAAGGTATACGACCCCGAGGTGGGCCAACGGGACAACCCGGCCGAGGCCAAGCACAGGAGG
CTCTTCCGAAGCTCTCACAGACACGGCATCCTGGACAAAGACCTCAAGCCGAACGCAAAGGTCCGCGACGAACTG
AACCTCATCATGTCATATTCGCCTACGCACATCTTATCGCCCGAGGAGACAGACCTGGTTTGGAAGTTTCGCTAC
CATCTCACTCGTGATAAGCGGGCTTTGACCAAATTCGTCAAGTCGGTCAACTGGAATGACCAGAGTGAAGCAAAG
CAGGCGATACAGGTTCTCGGCAGTTGGACTGAGATTGACGTCGATGATGCCCTTGAGCTGCTTGGCCCTTCCTTC
GACAACCCGGCTGTCCGATCCTACGCCGTCGACCGGCTGCGAAAGGCCGACGATGCCGAGTTGCTACTGTACTTG
CTCCAGCTGGTGCAGGCGCTCAAGTACGAGCACATCTCGACCGAGTCGGACCATGACGGCGCGCAGGACTCGTCT
CTGGCCAGCTTCCTCATCCAGCGGGCGGCTGCCAATTTTATGCTCGGCAACTATCTGTACTGGTATCTCATGGTG
GAATGCGATGACCACAGCCCGGAGCAGGGCCTTGACAACCGCAACATCTACCGCAAGGTCGCCTACGAGTTTATG
ACGCAGCTCGTCCGGCAGCCGGACGGGGCGGAGAACCGGAAGACGCTGCTGCGGCAGGCCGAGCTGGTGGCTATA
CTATCCAAGATAGCGGGCGAGGTCAAGGTGTCGAACGAGTCCATCGCCAAAAAGGTTGACCGCGTCAAGACGTTT
TTGGCAGACCCAAAGAACGAGCTGGTGACGCTGGATCCGCCGCTGGCAATGCCGCTCGACCCGTCGGTCAAGATA
ACGGGCGTGGCTGCCGATCAGGTGACGGTCTTCAAGTCGTCACTCAACCCCATCAAGATCACCTTCAAGACGACA
AACGGCAGCGCCTATCCCATCATCTTCAAGCTCGGCGATGACCTGCGCCAGGACCAGTTGGTGATTCAGATCATC
ACGCTCATGGAGCAGCTGCTGCGCAAGGAGAACTTGGATCTGAAGCTGTCACCGTACAAGATCCTGGCAACGAGC
ACGACGGCGGGCGCTTCGCAGTTTGTGCAGTCCCAGAGCCTGTCTAGCATCGTGGGCAAGTTCAAGACGAACCCG
GCGCTGGCTTACCTGCGGCATCACAACCCGGACGACAGGCAGCCGCTCGGGGTTCGTCAGGAGACGCTCGACACG
TACATCAAGTCGTGTGCCGGCTACTGCGTCATCACCTACATCCTCGGCGTCGGCGACCGTCATCTCGATAACCTG
CTTCTCGCGCCGGACGGTCACTTCTTCCATGCCGATTTCGGCTTCATTCTCGGTAGAGACCCCAAGCCGTTTGCG
CCGGTCATGAAGCTGTCCAAGGAGATGGTCGAGTGTATGGGCGGCGTCCACTCGGAGCACTACCAGCGCTTCCGC
CAGTACTGCTTCCTCGCCTACACGGCGCTGCGCAAGTCGTCGAACCTGATACTCAACCTGTTCAGTCTCATGGTC
CACGCGAATATCCCGGACATTCGACTCGAGCCGGACAAGGCCGTCATCAAGGTCCGGGAGCGCTTCCACCTCGAG
CTCACGGAGGAGGAAGCCATTGTCTACTTTGGCAACGTCATTGATGGCACGCTGACGGCGTTTGCGCCCGTTGTC
ATCGACAAGCTGCACGAGTGGGCGCAGGCGTTGCGGGCTTAG
Gene >Ophun1|1449
ATGACAGACTACGGGAGGATGGACCCCTTCTCATTTGCGGGGTCCAAGGACGTCAATCATCCCGTCAGCATCCGC
ATGTGAGTCTCTTCCCATCCTCCGTCTGATCGCCCTACTGATCGTCCCGCTTGCGTCTGCAGAATGAACCTGGAC
GGTGAAGAGCCTCCGGTTAAGTCCTCGACGCTTCTCGACCGTCCTGATCTGCGACACATCGGCTCGAACACAAGG
TTGGCTGTTAGGGTGCTGTGGGCGGACTCGGGACTGATGCGTGTTGCAGTCCCTTCTCCGACCTCTACGTCACGG
TTCAGGTCTGGGCTGGCTCGAAACCCCTGACTGTTCCCGTGCAGACGGCTTACAAGTCGTTTCGCTCGGAGAGAA
AGTCCGTCGCCCGCCTCAGTCGACGATGACGTGCTGATGAGATCGCGACAGATGGAACGAGTGGCTCGAGCTGCC
CATCACCTACAAGCAGCTGCCGGTAAATGCCCGCTTGGCCATGACCATATGGGACTTGTCGCCGACGGGAGGCAA
AAACGCCATCGATCATGCGATTCCCTTTGGCGGCACCACATTACCCCTGTTCGACGCAGATAACCAGGTGCAAAA
GGGACGTCAGAAGTGCCTCGTGCACAGGCATAAACATGCGGACGGATCCGACAACTCCACGACACCAGCTTTGCT
GGCTCCAAAAAGGACCTCGAGCTCGAGAGCTGGCAAAGCTCCGTTGACCGATAAGGACGCTGAGGAGCTGGACAG
GATGGAGAAGCTCTTCAAGAAACACGAGATGGGCGAGATTCCGCGTGTCGATTGGTTGGATCAGATGGTCTTTCG
CAGCTTTGAGAAGCGTGGACTCCAGGCTGCCCAGTCGTCCATGAAGATGCTCCAGCGTCAGCGCGCTGTCAATGG
CGATGACGAGGCCGGTGCCAAGGACGATGGATCTTCAAGCCCGTCCGCCTTTCTTCTCAACGTCGAGCTCCCGCG
GTTCGACTTTCCCGTCGTCTTTGCAGATCATGAATACGATCCGCCGCCGATTTCGTCTCTGCAGCCTCTTTCGGC
TTCGCAAGCCAGCATTTCCCAGCGACAGCCTCAAGTTCACTTTGGTCCGGGCATCAACGGCCTAGGAGAAAGCTC
CGAGGGCTTCGGGGCGCGCCTCATCAAGGTATACGACCCCGAGGTGGGCCAACGGGACAACCCGGCCGAGGCCAA
GCACAGGAGGCTCTTCCGAAGCTCTCACAGACACGGCATCCTGGACAAAGACCTCAAGCCGAACGCAAAGGTCCG
CGACGAACTGAACCTCATCATGTCATATTCGCCTACGCACATCTTATCGCCCGAGGAGACAGACCTGGTTTGGAA
GTTTCGCTACCATCTCACTCGTGATAAGCGGGCTTTGACCAAATTCGTCAAGTCGGTCAACTGGAATGACCAGAG
TGAAGCAAAGCAGGCGATACAGGTTCTCGGCAGTTGGACTGAGATTGACGTCGATGATGCCCTTGAGCTGCTTGG
CCCTTCCTTCGACAACCCGGCTGTCCGATCCTACGCCGTCGACCGGCTGCGAAAGGCCGACGATGCCGAGTTGCT
ACTGTACTTGCTCCAGCTGGTGCAGGCGCTCAAGTACGAGCACATCTCGACCGAGTCGGACCATGACGGCGCGCA
GGACTCGTCTCTGGCCAGCTTCCTCATCCAGCGGGCGGCTGCCAATTTTATGCTCGGCAACTATCTGTACTGGTA
TCTCATGGTGGAATGCGATGACCACAGCCCGGAGCAGGGCCTTGACAACCGCAACATCTACCGCAAGGTCGCCTA
CGAGTTTATGACGCAGCTCGTCCGGCAGCCGGACGGGGCGGAGAACCGGAAGACGCTGCTGCGGCAGGCCGAGCT
GGTGGCTATACTATCCAAGATAGCGGGCGAGGTCAAGGTGTCGAACGAGTCCATCGCCAAAAAGGTTGACCGCGT
CAAGACGTTTTTGGCAGACCCAAAGAACGAGCTGGTGACGCTGGATCCGCCGCTGGCAATGCCGCTCGACCCGTC
GGTCAAGATAACGGGCGTGGCTGCCGATCAGGTGACGGTCTTCAAGTCGTCACTCAACCCCATCAAGATCACCTT
CAAGACGACAAACGGCAGCGCCTATCCCATCATCTTCAAGCTCGGCGATGACCTGCGCCAGGACCAGTTGGTGAT
TCAGATCATCACGCTCATGGAGCAGCTGCTGCGCAAGGAGAACTTGGATCTGAAGCTGTCACCGTACAAGATCCT
GGCAACGAGCACGACGGCGGGCGCTTCGCAGTTTGTGCAGTCCCAGAGCCTGTCTAGCATCGTGGGCAAGTTCAA
GACGAACCCGGCGCTGGCTTACCTGCGGCATCACAACCCGGACGACAGGCAGCCGCTCGGGGTTCGTCAGGAGAC
GCTCGACACGTACATCAAGTCGTGTGCCGGCTACTGCGTCATCACCTACATCCTCGGCGTCGGCGACCGTCATCT
CGATAACCTGCTTCTCGCGCCGGACGGTCACTTCTTCCATGCCGATTTCGGCTTCATTCTCGGTAGAGACCCCAA
GCCGTTTGCGCCGGTCATGAAGCTGTCCAAGGAGATGGTCGAGTGTATGGGCGGCGTCCACTCGGAGCACTACCA
GCGCTTCCGCCAGTACTGCTTCCTCGCCTACACGGCGCTGCGCAAGTCGTCGAACCTGATACTCAACCTGTTCAG
TCTCATGGTCCACGCGAATATCCCGGACATTCGACTCGAGCCGGACAAGGCCGTCATCAAGGTCCGGGAGCGCTT
CCACCTCGAGCTCACGGAGGAGGAAGCCATTGTCTACTTTGGCAACGTCATTGATGGCACGCTGACGGCGTTTGC
GCCCGTTGTCATCGACAAGCTGCACGAGTGGGCGCAGGCGTTGCGGGCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail