Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1447
Gene name
LocationContig_159:17590..18973
Strand+
Gene length (bp)1383
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08743 Nse4_C Nse4 C-terminal 1.5E-33 329 417
PF15412 Nse4-Nse3_bdg Binding domain of Nse4/EID3 to Nse3-MAGE 1.7E-14 125 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 72 434 3.0E-26
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation 3 OS=Mus musculus GN=Eid3 PE=1 SV=1 57 419 5.0E-24
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE4 PE=1 SV=1 69 417 3.0E-22
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 74 417 2.0E-17
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation 3 OS=Bos taurus GN=EID3 PE=2 SV=1 329 419 9.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 72 434 3.0E-26
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation 3 OS=Mus musculus GN=Eid3 PE=1 SV=1 57 419 5.0E-24
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE4 PE=1 SV=1 69 417 3.0E-22
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 74 417 2.0E-17
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation 3 OS=Bos taurus GN=EID3 PE=2 SV=1 329 419 9.0E-17
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 329 419 2.0E-16
sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiation 3 OS=Macaca fascicularis GN=EID3 PE=2 SV=1 329 419 3.0E-16
sp|Q4V8G2|EID3_RAT EP300-interacting inhibitor of differentiation 3 OS=Rattus norvegicus GN=Eid3 PE=2 SV=2 329 419 2.0E-15
sp|Q2TBI1|NSE4A_BOVIN Non-structural maintenance of chromosomes element 4 homolog A OS=Bos taurus GN=NSMCE4A PE=2 SV=1 329 421 1.0E-13
sp|Q9C689|NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A OS=Arabidopsis thaliana GN=NSE4A PE=2 SV=1 70 421 3.0E-11
sp|F4JET1|NSE4B_ARATH Non-structural maintenance of chromosomes element 4 homolog B OS=Arabidopsis thaliana GN=NSE4B PE=2 SV=1 65 421 4.0E-10
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 71 143 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4352
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4977
Ophiocordyceps australis map64 (Brazil) OphauB2|1945
Ophiocordyceps camponoti-floridani Ophcf2|03493
Ophiocordyceps camponoti-rufipedis Ophun1|1447 (this protein)
Ophiocordyceps kimflemingae Ophio5|4120
Ophiocordyceps subramaniannii Hirsu2|895

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1447
MPTRVQHQVDDDDDDSPAGSPPSPSLAIRRSSLDTNKRKRDDSVNGQPSRRQRFSVPDGMDDVFDPDQPLEERRI
LQRQYRELLREINEKREEYLGSESNGLHDTIRKADELAKKLHQTTDAAIDSRLLVSTSDLSYRKALRLAQGSLST
GIDAEDLVSKCIVYMRNGSGIADNDAPELSSTQRQRRGAPQGTEQQDGDEGEEIGDDGDMMNWAHLGRFACLPFL
RRPALSGFLLGPLSVEKKARKLTQRSAPFRPNSLTETRPEVLNVDDLANKENDLTVLCGKILQQLQQKQVDAQET
VAELIDDDMDDAEKTSMMHDHGLRSTGGLDLMRFVVNPKSFAQTVENMFYVSFLIRDGRIQVEMDEHDLPSLAPV
DREVDTQATTRHSASKHQAVLSMDMQTWRDIIQAFNLTEPMIQHRQEVTSSGPGARGWYS*
Coding >Ophun1|1447
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACTCTCCCGCTGGATCGCCACCTTCGCCTAGC
CTCGCCATCCGTCGCTCATCGCTAGATACGAACAAGCGGAAGCGTGATGATAGCGTTAATGGACAGCCCAGCCGC
CGTCAGAGATTCTCGGTGCCCGACGGCATGGACGACGTCTTCGACCCGGATCAGCCCCTAGAGGAGCGCCGCATT
CTGCAGAGACAGTACCGTGAACTGCTACGCGAGATCAACGAAAAGCGCGAAGAGTATCTCGGCTCCGAATCCAAC
GGCCTGCACGACACTATTCGCAAGGCAGACGAACTGGCCAAGAAACTGCATCAGACGACCGATGCCGCCATCGAC
TCCCGCCTGCTCGTCAGCACCAGCGACTTGTCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGCCTTTCGACG
GGCATTGACGCCGAGGATCTCGTCTCCAAGTGCATCGTGTACATGAGGAACGGCTCCGGCATCGCTGACAATGAC
GCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGGGGCGCCGCAGGGAACGGAACAGCAAGATGGTGATGAG
GGCGAGGAGATTGGTGACGACGGAGATATGATGAACTGGGCGCATCTCGGACGCTTCGCCTGTCTTCCCTTCTTG
CGACGCCCTGCTCTGTCCGGCTTCCTCCTCGGACCGCTATCAGTGGAAAAGAAGGCGCGCAAGTTGACACAGCGG
AGCGCGCCCTTTCGCCCCAACAGCCTGACGGAGACGAGGCCCGAGGTGCTCAACGTCGACGACCTTGCCAACAAG
GAGAATGACTTGACCGTCCTCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAACAGGTGGATGCCCAGGAGACG
GTGGCGGAACTCATCGACGACGACATGGACGACGCTGAAAAGACGAGCATGATGCACGACCATGGTCTCCGCAGT
ACCGGCGGTCTTGACCTTATGCGATTCGTCGTCAATCCCAAGTCTTTTGCACAGACGGTTGAGAACATGTTTTAC
GTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGACGAGCATGACCTCCCGTCTCTGGCCCCCGTC
GACCGCGAAGTAGACACCCAAGCCACCACCCGCCACAGCGCGTCCAAGCACCAAGCCGTGCTGTCCATGGACATG
CAAACCTGGCGCGACATAATCCAAGCCTTTAACCTGACAGAGCCCATGATCCAGCACCGTCAGGAAGTGACCAGC
TCTGGCCCCGGCGCTCGCGGCTGGTACAGCTGA
Transcript >Ophun1|1447
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACTCTCCCGCTGGATCGCCACCTTCGCCTAGC
CTCGCCATCCGTCGCTCATCGCTAGATACGAACAAGCGGAAGCGTGATGATAGCGTTAATGGACAGCCCAGCCGC
CGTCAGAGATTCTCGGTGCCCGACGGCATGGACGACGTCTTCGACCCGGATCAGCCCCTAGAGGAGCGCCGCATT
CTGCAGAGACAGTACCGTGAACTGCTACGCGAGATCAACGAAAAGCGCGAAGAGTATCTCGGCTCCGAATCCAAC
GGCCTGCACGACACTATTCGCAAGGCAGACGAACTGGCCAAGAAACTGCATCAGACGACCGATGCCGCCATCGAC
TCCCGCCTGCTCGTCAGCACCAGCGACTTGTCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGCCTTTCGACG
GGCATTGACGCCGAGGATCTCGTCTCCAAGTGCATCGTGTACATGAGGAACGGCTCCGGCATCGCTGACAATGAC
GCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGGGGCGCCGCAGGGAACGGAACAGCAAGATGGTGATGAG
GGCGAGGAGATTGGTGACGACGGAGATATGATGAACTGGGCGCATCTCGGACGCTTCGCCTGTCTTCCCTTCTTG
CGACGCCCTGCTCTGTCCGGCTTCCTCCTCGGACCGCTATCAGTGGAAAAGAAGGCGCGCAAGTTGACACAGCGG
AGCGCGCCCTTTCGCCCCAACAGCCTGACGGAGACGAGGCCCGAGGTGCTCAACGTCGACGACCTTGCCAACAAG
GAGAATGACTTGACCGTCCTCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAACAGGTGGATGCCCAGGAGACG
GTGGCGGAACTCATCGACGACGACATGGACGACGCTGAAAAGACGAGCATGATGCACGACCATGGTCTCCGCAGT
ACCGGCGGTCTTGACCTTATGCGATTCGTCGTCAATCCCAAGTCTTTTGCACAGACGGTTGAGAACATGTTTTAC
GTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGACGAGCATGACCTCCCGTCTCTGGCCCCCGTC
GACCGCGAAGTAGACACCCAAGCCACCACCCGCCACAGCGCGTCCAAGCACCAAGCCGTGCTGTCCATGGACATG
CAAACCTGGCGCGACATAATCCAAGCCTTTAACCTGACAGAGCCCATGATCCAGCACCGTCAGGAAGTGACCAGC
TCTGGCCCCGGCGCTCGCGGCTGGTACAGCTGA
Gene >Ophun1|1447
ATGCCGACACGCGTCCAGCATCAGGTCGACGACGACGACGACGACTCTCCCGCTGGATCGCCACCTTCGCCTAGC
CTCGCCATCCGTCGCTCATCGCTAGATACGAACAAGCGGAAGCGTGATGATAGCGTTAATGGACAGCCCAGCCGC
CGTCAGAGATTCTCGGTGCCCGACGGCATGGACGACGTCTTCGACCCGGATCAGCCCCTAGAGGAGCGCCGCATT
CTGCAGAGACAGTACCGTGAACTGCTACGCGAGATCAACGAAAAGCGCGAAGAGTATCTCGGCTCCGAATCCAAC
GGCCTGCACGACACTATTCGCAAGGCAGACGAACTGGCCAAGAAACTGCATCAGACGACCGATGCCGCCATCGAC
TCCCGCCTGCTCGTCAGCACCAGCGACTTGTCGTACCGCAAAGCCCTTCGTCTCGCTCAGGGAAGCCTTTCGACG
GGCATTGACGCCGAGGATCTCGTCTCCAAGTGCATCGTGTACATGAGGAACGGCTCCGGCATCGCTGACAATGAC
GCGCCGGAGCTGTCTAGTACGCAGAGGCAGCGTCGGGGGGCGCCGCAGGGAACGGAACAGCAAGATGGTGATGAG
GGCGAGGAGATTGGTGACGACGGAGATATGATGAACTGGGCGCATCTCGGACGCTTCGCCTGTCTTCCCTTCTTG
CGACGCCCTGCTCTGTCCGGCTTCCTCCTCGGACCGCTATCAGTGGAAAAGAAGGCGCGCAAGTTGACACAGCGG
AGCGCGCCCTTTCGCCCCAACAGCCTGACGGAGACGAGGCCCGAGGTGCTCAACGTCGACGACCTTGCCAACAAG
GAGAATGACTTGACCGTCCTCTGCGGCAAGATCCTACAGCAGCTGCAGCAGAAACAGGTGGATGCCCAGGAGACG
GTGGCGGAACTCATCGACGACGACATGGACGACGCTGAAAAGACGAGCATGATGCACGACCATGGTCTCCGCAGT
ACCGGCGGTCTTGACCTTATGCGATTCGTCGTCAATCCCAAGTCTTTTGCACAGACGGTTGAGAACATGTTTTAC
GTTAGCTTTCTCATCCGCGATGGGAGGATACAGGTCGAGATGGACGAGCATGACCTCCCGTCTCTGGGTGAGTCT
CTTTTCTTTTGTCCGCAGCATCTTCCTTTGACCTCGGTTCGACTGACGGGATATTCACCTTCCAAAGCCCCCGTC
GACCGCGAAGTAGACACCCAAGCCACCACCCGCCACAGCGCGTCCAAGCACCAAGCCGTGCTGTCCATGGACATG
CAAACCTGGCGCGACATAATCCAAGCCTTTAACCTGACAGAGCCCATGATCCAGCACCGTCAGGAAGTGACCAGC
TCTGGCCCCGGCGCTCGCGGCTGGTACAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail