Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1443
Gene name
LocationContig_159:10457..12533
Strand+
Gene length (bp)2076
Transcript length (bp)2076
Coding sequence length (bp)2076
Protein length (aa) 692

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.999699

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup513
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2042
Ophiocordyceps australis 1348a (Ghana) OphauG2|2043
Ophiocordyceps australis map64 (Brazil) OphauB2|330
Ophiocordyceps camponoti-floridani Ophcf2|03497
Ophiocordyceps camponoti-rufipedis Ophun1|1443 (this protein)
Ophiocordyceps kimflemingae Ophio5|1795
Ophiocordyceps subramaniannii Hirsu2|2153
Ophiocordyceps subramaniannii Hirsu2|2505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1443
MHLLLPLSLLALGAGAQEPPNNDINKACALVSEVNGELEPPKPGQENSTKPRRRIIPARLAHDCLKSIPFDKERA
EGFVPQLLKYLGFQSTLVLLMNPPVQWVFPPIDIPRRLRDLVVGSDNQTDVDKRVDFDNQYDFDVAINNAITEAH
DAHLRLQLCSLSIFDFRRDHPGIASVSKDGLEIPEIYAATDVEHLAKGDNDKVSPIKTINGEDVVGFLKKRALDS
SAQSRDAQWNELFVSPAFGFQLKTGQFVSNHGKWPGADVTTITFDNGTTVEAKTIAFADSKKRFNETTPAEVFDA
YCVPKGPPPPRTRRNGTLPDIPNLPKPFAHDPLNEMLGFNLDNETVVLKLTSFGSAEKDRTYSVLIHNLTNTIFQ
KAKESGRTKIIIDVSSNPGGHLARYLDLFGLLFPDIVPTENRRLGRTEQVTALVQANTVFNESESRHQAFTFAHK
ALTRPDLKTGFPTAQDFLSNTTLEGQPVTAPFNFISLLQSNNSPIAGFGDNAFDDNKPPERPFRVEDMLIVGNGI
CHSSCAAFLHLMTTQALVKTIVFGGLHSLDEMDIIGGVRGGEVAPFLGLSAMMKKAKERLLDSTNEISLSQSERE
KAAESLPKPLEDLPLTVDGAVNLQSMYTTDGDDGQTLHFLPSPANFRRFYTARNLADPKTVWEDAKEAVWGGGQR
INQSEEVAKNESGQAR*
Coding >Ophun1|1443
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAGCCTCCTAACAACGACATCAAC
AAGGCCTGTGCCCTCGTCAGCGAAGTCAATGGCGAGCTGGAGCCTCCGAAGCCAGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGAATTATCCCCGCCCGGTTGGCCCATGACTGTCTCAAATCGATTCCTTTTGATAAAGAGCGCGCC
GAAGGATTTGTTCCTCAGCTTCTGAAGTATCTGGGGTTCCAGTCGACCCTCGTCCTGCTCATGAACCCCCCGGTG
CAGTGGGTCTTTCCACCCATCGACATCCCTCGAAGACTGCGTGATCTCGTGGTCGGCTCCGACAATCAGACAGAC
GTCGACAAACGAGTCGACTTCGACAATCAGTACGACTTCGATGTTGCCATCAATAACGCCATAACAGAGGCTCAT
GATGCTCATCTCCGCTTGCAGCTCTGCTCGCTGTCCATCTTCGATTTCCGGCGAGATCATCCCGGCATCGCCTCC
GTGTCCAAGGACGGCCTGGAAATTCCCGAGATCTATGCGGCCACTGATGTCGAACATCTTGCCAAGGGAGACAAC
GACAAGGTCTCCCCCATCAAGACCATCAACGGCGAGGACGTCGTGGGATTCCTCAAAAAGAGGGCCCTCGACTCC
TCCGCGCAGAGTAGGGATGCCCAGTGGAACGAGCTCTTCGTCAGCCCGGCGTTCGGATTCCAGCTCAAGACTGGA
CAGTTCGTCAGCAACCACGGAAAATGGCCCGGTGCTGATGTGACTACCATCACTTTCGATAATGGCACCACGGTC
GAGGCCAAGACGATTGCCTTTGCCGATAGCAAGAAGCGTTTCAATGAAACGACGCCGGCTGAAGTCTTTGATGCG
TACTGCGTGCCAAAGGGTCCTCCGCCGCCGCGCACTCGCAGGAACGGAACGCTTCCCGACATCCCGAATCTTCCC
AAGCCCTTTGCGCACGATCCCCTCAACGAGATGCTGGGCTTCAACCTCGACAATGAGACCGTCGTCTTGAAGTTG
ACCTCATTTGGTTCTGCCGAGAAGGACAGGACGTACTCGGTCCTCATCCACAACCTGACCAACACCATCTTCCAA
AAGGCCAAGGAGTCGGGCCGCACCAAGATAATCATCGACGTGTCCAGCAACCCCGGCGGCCATCTCGCTCGATAC
CTTGACCTCTTCGGCCTTTTGTTCCCGGATATTGTTCCGACGGAGAACCGCCGGCTTGGACGGACCGAGCAGGTG
ACGGCCTTGGTTCAGGCTAACACCGTCTTCAATGAGTCCGAGTCGAGGCATCAGGCCTTTACTTTTGCCCACAAG
GCGCTCACCAGACCCGACCTGAAGACGGGATTCCCAACTGCGCAGGACTTTCTCAGCAATACAACACTCGAAGGC
CAGCCCGTGACGGCGCCTTTCAACTTCATTTCCCTGCTCCAGTCCAACAATTCGCCCATTGCCGGCTTTGGCGAT
AATGCCTTTGACGACAACAAGCCGCCGGAGCGACCGTTCCGTGTGGAAGACATGCTCATCGTCGGCAACGGCATC
TGCCACTCTTCCTGCGCCGCCTTTCTTCACCTCATGACCACGCAGGCCCTCGTCAAGACCATTGTCTTTGGAGGA
CTGCACAGTCTCGACGAGATGGACATCATCGGCGGCGTTCGCGGTGGCGAGGTAGCACCCTTCCTCGGGCTCTCA
GCCATGATGAAAAAGGCAAAGGAGAGACTTCTCGACTCGACCAACGAAATCTCCCTCAGCCAGTCGGAACGCGAA
AAGGCAGCCGAATCGCTGCCCAAGCCGCTGGAGGACCTGCCGTTGACAGTGGACGGCGCCGTCAACCTGCAGAGC
ATGTACACGACTGACGGTGACGACGGCCAGACGTTGCACTTCCTGCCAAGCCCTGCCAACTTCCGTCGTTTCTAC
ACGGCGCGTAATCTCGCGGACCCGAAGACGGTCTGGGAGGATGCCAAGGAGGCGGTTTGGGGGGGTGGCCAGCGT
ATCAATCAGTCAGAGGAGGTGGCGAAGAACGAGTCGGGTCAGGCGCGTTGA
Transcript >Ophun1|1443
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAGCCTCCTAACAACGACATCAAC
AAGGCCTGTGCCCTCGTCAGCGAAGTCAATGGCGAGCTGGAGCCTCCGAAGCCAGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGAATTATCCCCGCCCGGTTGGCCCATGACTGTCTCAAATCGATTCCTTTTGATAAAGAGCGCGCC
GAAGGATTTGTTCCTCAGCTTCTGAAGTATCTGGGGTTCCAGTCGACCCTCGTCCTGCTCATGAACCCCCCGGTG
CAGTGGGTCTTTCCACCCATCGACATCCCTCGAAGACTGCGTGATCTCGTGGTCGGCTCCGACAATCAGACAGAC
GTCGACAAACGAGTCGACTTCGACAATCAGTACGACTTCGATGTTGCCATCAATAACGCCATAACAGAGGCTCAT
GATGCTCATCTCCGCTTGCAGCTCTGCTCGCTGTCCATCTTCGATTTCCGGCGAGATCATCCCGGCATCGCCTCC
GTGTCCAAGGACGGCCTGGAAATTCCCGAGATCTATGCGGCCACTGATGTCGAACATCTTGCCAAGGGAGACAAC
GACAAGGTCTCCCCCATCAAGACCATCAACGGCGAGGACGTCGTGGGATTCCTCAAAAAGAGGGCCCTCGACTCC
TCCGCGCAGAGTAGGGATGCCCAGTGGAACGAGCTCTTCGTCAGCCCGGCGTTCGGATTCCAGCTCAAGACTGGA
CAGTTCGTCAGCAACCACGGAAAATGGCCCGGTGCTGATGTGACTACCATCACTTTCGATAATGGCACCACGGTC
GAGGCCAAGACGATTGCCTTTGCCGATAGCAAGAAGCGTTTCAATGAAACGACGCCGGCTGAAGTCTTTGATGCG
TACTGCGTGCCAAAGGGTCCTCCGCCGCCGCGCACTCGCAGGAACGGAACGCTTCCCGACATCCCGAATCTTCCC
AAGCCCTTTGCGCACGATCCCCTCAACGAGATGCTGGGCTTCAACCTCGACAATGAGACCGTCGTCTTGAAGTTG
ACCTCATTTGGTTCTGCCGAGAAGGACAGGACGTACTCGGTCCTCATCCACAACCTGACCAACACCATCTTCCAA
AAGGCCAAGGAGTCGGGCCGCACCAAGATAATCATCGACGTGTCCAGCAACCCCGGCGGCCATCTCGCTCGATAC
CTTGACCTCTTCGGCCTTTTGTTCCCGGATATTGTTCCGACGGAGAACCGCCGGCTTGGACGGACCGAGCAGGTG
ACGGCCTTGGTTCAGGCTAACACCGTCTTCAATGAGTCCGAGTCGAGGCATCAGGCCTTTACTTTTGCCCACAAG
GCGCTCACCAGACCCGACCTGAAGACGGGATTCCCAACTGCGCAGGACTTTCTCAGCAATACAACACTCGAAGGC
CAGCCCGTGACGGCGCCTTTCAACTTCATTTCCCTGCTCCAGTCCAACAATTCGCCCATTGCCGGCTTTGGCGAT
AATGCCTTTGACGACAACAAGCCGCCGGAGCGACCGTTCCGTGTGGAAGACATGCTCATCGTCGGCAACGGCATC
TGCCACTCTTCCTGCGCCGCCTTTCTTCACCTCATGACCACGCAGGCCCTCGTCAAGACCATTGTCTTTGGAGGA
CTGCACAGTCTCGACGAGATGGACATCATCGGCGGCGTTCGCGGTGGCGAGGTAGCACCCTTCCTCGGGCTCTCA
GCCATGATGAAAAAGGCAAAGGAGAGACTTCTCGACTCGACCAACGAAATCTCCCTCAGCCAGTCGGAACGCGAA
AAGGCAGCCGAATCGCTGCCCAAGCCGCTGGAGGACCTGCCGTTGACAGTGGACGGCGCCGTCAACCTGCAGAGC
ATGTACACGACTGACGGTGACGACGGCCAGACGTTGCACTTCCTGCCAAGCCCTGCCAACTTCCGTCGTTTCTAC
ACGGCGCGTAATCTCGCGGACCCGAAGACGGTCTGGGAGGATGCCAAGGAGGCGGTTTGGGGGGGTGGCCAGCGT
ATCAATCAGTCAGAGGAGGTGGCGAAGAACGAGTCGGGTCAGGCGCGTTGA
Gene >Ophun1|1443
ATGCATCTTCTTCTACCTCTTTCGCTTCTCGCCCTGGGTGCCGGCGCCCAGGAGCCTCCTAACAACGACATCAAC
AAGGCCTGTGCCCTCGTCAGCGAAGTCAATGGCGAGCTGGAGCCTCCGAAGCCAGGCCAAGAGAACAGCACAAAA
CCCCGTCGCCGAATTATCCCCGCCCGGTTGGCCCATGACTGTCTCAAATCGATTCCTTTTGATAAAGAGCGCGCC
GAAGGATTTGTTCCTCAGCTTCTGAAGTATCTGGGGTTCCAGTCGACCCTCGTCCTGCTCATGAACCCCCCGGTG
CAGTGGGTCTTTCCACCCATCGACATCCCTCGAAGACTGCGTGATCTCGTGGTCGGCTCCGACAATCAGACAGAC
GTCGACAAACGAGTCGACTTCGACAATCAGTACGACTTCGATGTTGCCATCAATAACGCCATAACAGAGGCTCAT
GATGCTCATCTCCGCTTGCAGCTCTGCTCGCTGTCCATCTTCGATTTCCGGCGAGATCATCCCGGCATCGCCTCC
GTGTCCAAGGACGGCCTGGAAATTCCCGAGATCTATGCGGCCACTGATGTCGAACATCTTGCCAAGGGAGACAAC
GACAAGGTCTCCCCCATCAAGACCATCAACGGCGAGGACGTCGTGGGATTCCTCAAAAAGAGGGCCCTCGACTCC
TCCGCGCAGAGTAGGGATGCCCAGTGGAACGAGCTCTTCGTCAGCCCGGCGTTCGGATTCCAGCTCAAGACTGGA
CAGTTCGTCAGCAACCACGGAAAATGGCCCGGTGCTGATGTGACTACCATCACTTTCGATAATGGCACCACGGTC
GAGGCCAAGACGATTGCCTTTGCCGATAGCAAGAAGCGTTTCAATGAAACGACGCCGGCTGAAGTCTTTGATGCG
TACTGCGTGCCAAAGGGTCCTCCGCCGCCGCGCACTCGCAGGAACGGAACGCTTCCCGACATCCCGAATCTTCCC
AAGCCCTTTGCGCACGATCCCCTCAACGAGATGCTGGGCTTCAACCTCGACAATGAGACCGTCGTCTTGAAGTTG
ACCTCATTTGGTTCTGCCGAGAAGGACAGGACGTACTCGGTCCTCATCCACAACCTGACCAACACCATCTTCCAA
AAGGCCAAGGAGTCGGGCCGCACCAAGATAATCATCGACGTGTCCAGCAACCCCGGCGGCCATCTCGCTCGATAC
CTTGACCTCTTCGGCCTTTTGTTCCCGGATATTGTTCCGACGGAGAACCGCCGGCTTGGACGGACCGAGCAGGTG
ACGGCCTTGGTTCAGGCTAACACCGTCTTCAATGAGTCCGAGTCGAGGCATCAGGCCTTTACTTTTGCCCACAAG
GCGCTCACCAGACCCGACCTGAAGACGGGATTCCCAACTGCGCAGGACTTTCTCAGCAATACAACACTCGAAGGC
CAGCCCGTGACGGCGCCTTTCAACTTCATTTCCCTGCTCCAGTCCAACAATTCGCCCATTGCCGGCTTTGGCGAT
AATGCCTTTGACGACAACAAGCCGCCGGAGCGACCGTTCCGTGTGGAAGACATGCTCATCGTCGGCAACGGCATC
TGCCACTCTTCCTGCGCCGCCTTTCTTCACCTCATGACCACGCAGGCCCTCGTCAAGACCATTGTCTTTGGAGGA
CTGCACAGTCTCGACGAGATGGACATCATCGGCGGCGTTCGCGGTGGCGAGGTAGCACCCTTCCTCGGGCTCTCA
GCCATGATGAAAAAGGCAAAGGAGAGACTTCTCGACTCGACCAACGAAATCTCCCTCAGCCAGTCGGAACGCGAA
AAGGCAGCCGAATCGCTGCCCAAGCCGCTGGAGGACCTGCCGTTGACAGTGGACGGCGCCGTCAACCTGCAGAGC
ATGTACACGACTGACGGTGACGACGGCCAGACGTTGCACTTCCTGCCAAGCCCTGCCAACTTCCGTCGTTTCTAC
ACGGCGCGTAATCTCGCGGACCCGAAGACGGTCTGGGAGGATGCCAAGGAGGCGGTTTGGGGGGGTGGCCAGCGT
ATCAATCAGTCAGAGGAGGTGGCGAAGAACGAGTCGGGTCAGGCGCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail