Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1442
Gene name
LocationContig_159:8909..9277
Strand-
Gene length (bp)368
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05839 Apc13p Apc13p protein 2.5E-33 3 89

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74358|APC13_SCHPO Anaphase-promoting complex subunit 13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=apc13 PE=1 SV=1 4 82 2.0E-08

GO

GO Term Description Terminal node
GO:0005680 anaphase-promoting complex Yes
GO:0000152 nuclear ubiquitin ligase complex No
GO:1990234 transferase complex No
GO:0031461 cullin-RING ubiquitin ligase complex No
GO:1902494 catalytic complex No
GO:0005575 cellular_component No
GO:0000151 ubiquitin ligase complex No
GO:0140513 nuclear protein-containing complex No
GO:0140535 intracellular protein-containing complex No
GO:0032991 protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1442
MNKDGTFTYVHMHRSSDADLFDDFCKDALPPDDVYVPPAHRPINPEDEDDVVPDQHAAFGIQRATQRVTEPAWKD
LGLADLMRRGPKAQTAAKRPNASRAPR*
Coding >Ophun1|1442
ATGAACAAAGACGGCACCTTTACATACGTGCACATGCACCGCTCCTCAGACGCAGACCTCTTCGACGACTTCTGC
AAAGACGCGCTCCCGCCCGACGACGTCTACGTCCCGCCCGCCCACCGGCCCATCAACCCAGAAGACGAGGACGAC
GTCGTTCCAGACCAGCACGCCGCCTTTGGCATCCAGCGCGCTACTCAGCGCGTCACCGAGCCGGCTTGGAAGGAT
CTGGGGCTCGCAGACTTGATGCGTCGCGGGCCGAAGGCGCAGACTGCTGCTAAGCGGCCGAATGCGAGCCGTGCA
CCGCGGTGA
Transcript >Ophun1|1442
ATGAACAAAGACGGCACCTTTACATACGTGCACATGCACCGCTCCTCAGACGCAGACCTCTTCGACGACTTCTGC
AAAGACGCGCTCCCGCCCGACGACGTCTACGTCCCGCCCGCCCACCGGCCCATCAACCCAGAAGACGAGGACGAC
GTCGTTCCAGACCAGCACGCCGCCTTTGGCATCCAGCGCGCTACTCAGCGCGTCACCGAGCCGGCTTGGAAGGAT
CTGGGGCTCGCAGACTTGATGCGTCGCGGGCCGAAGGCGCAGACTGCTGCTAAGCGGCCGAATGCGAGCCGTGCA
CCGCGGTGA
Gene >Ophun1|1442
ATGGTACGCATCCATCTTCCCACCTCCGAAACCTACCCTAGACACATGCCTAACCTCAGCAGAACAAAGACGGCA
CCTTTACATACGTGCACATGCACCGCTCCTCAGACGCAGACCTCTTCGACGACTTCTGCAAAGACGCGCTCCCGC
CCGACGACGTCTACGTCCCGCCCGCCCACCGGCCCATCAACCCAGAAGACGAGGACGACGTCGTTCCAGACCAGC
ACGCCGCCTTTGGCATCCAGCGCGCTACTCAGCGCGTCACCGAGCCGGCTTGGAAGGATCTGGGGCTCGCAGACT
TGATGCGTCGCGGGCCGAAGGCGCAGACTGCTGCTAAGCGGCCGAATGCGAGCCGTGCACCGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail