Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|144
Gene name
LocationContig_1016:2618..4308
Strand-
Gene length (bp)1690
Transcript length (bp)1149
Coding sequence length (bp)1149
Protein length (aa) 383

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1915
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|660
Ophiocordyceps australis map64 (Brazil) OphauB2|4579
Ophiocordyceps camponoti-floridani Ophcf2|03882
Ophiocordyceps camponoti-rufipedis Ophun1|144 (this protein)
Ophiocordyceps kimflemingae Ophio5|1625
Ophiocordyceps subramaniannii Hirsu2|201

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|144
MTSSSVFSITPKPGRLLSPRLGAARAKPPETMSYYDSPQWSGPAQNNWDHQAAAAAAPVRAAGASGPQPQDDFAY
SYQFDEVDRAYENLQKSGKGYAMGGRRPDVRVSHGAGPRSHPVNTFDEARGPQPPSLHTFYASQRHQPSRGNNEA
EQFMQSKRRMAAQRERELRNRHTEQQYQRNDLTEPAQHGNKHMSEEETRELIARQRSALYGEGPFADKSSYVDES
GNIRPGAPRPSGPPSLRGPSPLTFDGIGRASSGPDATSPASIADHAAAAGPSPRPQSTTSPQTSGKPFDGAVGTQ
SRTSSSSPTRASPPRDLAPGSKSGQHSTTVAPIGTRPSASSSSATAAGKRSTTPLTSPGGWGRGNGVWGQSSGLG
AQASVWG*
Coding >Ophun1|144
ATGACCTCGTCGTCCGTCTTCTCCATCACCCCAAAACCAGGCAGATTGCTCTCGCCCCGACTGGGCGCCGCGCGT
GCGAAGCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCAT
CAGGCCGCCGCCGCAGCCGCTCCTGTTCGTGCTGCTGGTGCCAGCGGTCCTCAGCCTCAGGATGACTTTGCCTAT
TCCTACCAGTTTGACGAGGTCGACCGCGCCTATGAGAATCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGTGGT
CGCCGCCCCGACGTCCGAGTCTCCCACGGAGCCGGCCCGCGCTCTCATCCCGTCAACACCTTCGATGAGGCTCGC
GGCCCTCAGCCGCCCAGTCTTCACACCTTTTACGCTTCTCAGCGTCATCAACCCTCGCGGGGCAATAACGAGGCC
GAGCAGTTCATGCAGTCCAAGAGAAGGATGGCAGCCCAGCGGGAACGGGAACTGCGAAACCGACACACGGAGCAG
CAATATCAACGAAATGACTTGACCGAACCCGCCCAACATGGAAACAAGCACATGTCAGAAGAGGAGACGCGCGAG
CTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGACAAGAGTAGCTACGTCGATGAATCG
GGCAACATTCGACCGGGCGCACCGCGTCCCAGCGGTCCTCCCAGCCTGCGCGGACCCTCTCCTCTGACTTTCGAC
GGCATCGGACGCGCCTCCTCCGGCCCGGATGCCACCTCTCCGGCTTCGATAGCCGATCACGCCGCCGCCGCCGGT
CCCAGTCCCCGTCCGCAGAGTACCACCAGCCCGCAGACATCCGGAAAGCCCTTTGACGGTGCTGTCGGAACCCAG
AGCCGCACCAGCTCATCGAGCCCTACCCGGGCATCTCCTCCTCGCGACCTCGCCCCGGGTTCCAAGTCGGGCCAG
CACTCGACCACCGTCGCCCCCATCGGCACGCGTCCTTCCGCCTCGTCGTCGTCGGCTACTGCTGCCGGAAAGCGC
TCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAACGGTGTCTGGGGCCAATCTTCCGGTCTCGGC
GCCCAGGCTAGCGTCTGGGGCTGA
Transcript >Ophun1|144
ATGACCTCGTCGTCCGTCTTCTCCATCACCCCAAAACCAGGCAGATTGCTCTCGCCCCGACTGGGCGCCGCGCGT
GCGAAGCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCAT
CAGGCCGCCGCCGCAGCCGCTCCTGTTCGTGCTGCTGGTGCCAGCGGTCCTCAGCCTCAGGATGACTTTGCCTAT
TCCTACCAGTTTGACGAGGTCGACCGCGCCTATGAGAATCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGTGGT
CGCCGCCCCGACGTCCGAGTCTCCCACGGAGCCGGCCCGCGCTCTCATCCCGTCAACACCTTCGATGAGGCTCGC
GGCCCTCAGCCGCCCAGTCTTCACACCTTTTACGCTTCTCAGCGTCATCAACCCTCGCGGGGCAATAACGAGGCC
GAGCAGTTCATGCAGTCCAAGAGAAGGATGGCAGCCCAGCGGGAACGGGAACTGCGAAACCGACACACGGAGCAG
CAATATCAACGAAATGACTTGACCGAACCCGCCCAACATGGAAACAAGCACATGTCAGAAGAGGAGACGCGCGAG
CTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGACAAGAGTAGCTACGTCGATGAATCG
GGCAACATTCGACCGGGCGCACCGCGTCCCAGCGGTCCTCCCAGCCTGCGCGGACCCTCTCCTCTGACTTTCGAC
GGCATCGGACGCGCCTCCTCCGGCCCGGATGCCACCTCTCCGGCTTCGATAGCCGATCACGCCGCCGCCGCCGGT
CCCAGTCCCCGTCCGCAGAGTACCACCAGCCCGCAGACATCCGGAAAGCCCTTTGACGGTGCTGTCGGAACCCAG
AGCCGCACCAGCTCATCGAGCCCTACCCGGGCATCTCCTCCTCGCGACCTCGCCCCGGGTTCCAAGTCGGGCCAG
CACTCGACCACCGTCGCCCCCATCGGCACGCGTCCTTCCGCCTCGTCGTCGTCGGCTACTGCTGCCGGAAAGCGC
TCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAACGGTGTCTGGGGCCAATCTTCCGGTCTCGGC
GCCCAGGCTAGCGTCTGGGGCTGA
Gene >Ophun1|144
ATGACCTCGTCGTCCGTCTTCTCCATCACCCCAAAACCAGGTCCGCCGCACCGCTTCCACGGCCCGTCTCTACCC
GTCGCTACACACTTGTTTTTTTTTTTTTTTTTCCTAATTTTACTGGGCCAGCTCCCCTCGAGTCGTGTCCTGCTT
CTTCTCTGTCTCGTCTCGTCGGCTCATCTTCGCAGGCAGATTGCTCTCGCCCCGACTGGGCGCCGCGCGTGCGAA
GCCACCAGAAACCATGTCCTACTACGACAGTCCTCAGTGGTCTGGCCCTGCCCAGAACAATTGGGACCATCAGGC
CGCCGCCGCAGCCGCTCCTGTTCGTGCTGGTACGAGCTGCTCCCCTGTTCTATTCGCCTCTGCTTCATCGATTTT
AATGCTCGTCTTCAGCTGGTGCCAGCGGTCCTCAGCCTCAGGATGACTTTGCCTATTCCTACCAGTTTGACGGTA
TGGCTGCCTCCCCTCTGATCTTACAGTTTGTCAGGTTACTGACCCGTGCTTCACCTTGATACAGAGGTCGACCGC
GCCTATGAGAATCTTCAAAAGTCCGGCAAGGGCTATGCCATGGGTGGTCGCCGTGAGTATTCGCCTGAAATCCCC
CATCCTTCCGGGCTCACCTCCGTCACGGGCCTGGCCTTGATAAGGCATCATCCGCTGACCCATCTTTCCATAGGC
CCCGACGTCCGAGTCTCCCACGGAGCCGGCCCGCGCTCTCATCCCGTCAACACCTTCGATGAGGCTCGCGGCCCT
CAGCCGCCCAGTCTTCACACCTTTTACGCTTCTCAGCGTCATCAACCCTCGCGGGGCAATAACGAGGCCGAGCAG
TTCATGCAGTCCAAGAGAAGGATGGCAGCCCAGCGGGAACGGGAACTGCGAAACCGACACACGGAGCAGCAATAT
CAACGAAGTATGCCGTCCTCAACTGTTTAGCCTTGACGAATCCCATCGAAAATATTCATCCCCTCTCCCCTTGTT
TTACACACAAGAGAAATAGATTCGAAACGCCGCCGTCTCTTCATCATGGCCATGGCCTCTCGCCGCTCTTGTCGA
ATGTATGCTAACCGTCGTCTCCAACGTAGATGACTTGACCGAACCCGCCCAACATGGAAACAAGCACATGTCAGA
AGAGGAGACGCGCGAGCTCATCGCCCGCCAGCGCAGCGCCCTCTACGGAGAGGGCCCCTTCGCCGACAAGAGTAG
CTACGTCGATGAATCGGGCAACATTCGACCGGGCGCACCGCGTCCCAGCGGTCCTCCCAGCCTGCGCGGACCCTC
TCCTCTGACTTTCGACGGCATCGGACGCGCCTCCTCCGGCCCGGATGCCACCTCTCCGGCTTCGATAGCCGATCA
CGCCGCCGCCGCCGGTCCCAGTCCCCGTCCGCAGAGTACCACCAGCCCGCAGACATCCGGAAAGCCCTTTGACGG
TGCTGTCGGAACCCAGAGCCGCACCAGCTCATCGAGCCCTACCCGGGCATCTCCTCCTCGCGACCTCGCCCCGGG
TTCCAAGTCGGGCCAGCACTCGACCACCGTCGCCCCCATCGGCACGCGTCCTTCCGCCTCGTCGTCGTCGGCTAC
TGCTGCCGGAAAGCGCTCCACCACCCCTCTCACTTCGCCGGGAGGCTGGGGCCGCGGCAACGGTGTCTGGGGCCA
ATCTTCCGGTCTCGGCGCCCAGGCTAGCGTCTGGGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail