Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1430
Gene name
LocationContig_158:19741..23274
Strand+
Gene length (bp)3533
Transcript length (bp)3471
Coding sequence length (bp)3471
Protein length (aa) 1157

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13515 FUSC_2 Fusaric acid resistance protein-like 1.1E-11 700 830
PF10337 ArAE_2_N Putative ER transporter, 6TM, N-terminal 2.2E-10 145 396

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 684 1072 3.0E-53
sp|P53120|YGO0_YEAST Uncharacterized membrane protein YGL140C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGL140C PE=1 SV=1 66 625 2.0E-24
sp|Q10495|YDG8_SCHPO Uncharacterized protein C26F1.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26F1.08c PE=4 SV=1 661 1061 2.0E-18
sp|P87136|YDM5_SCHPO Uncharacterized protein C57A7.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.05 PE=4 SV=1 684 1061 5.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22
2 111 133 22
3 140 162 22
4 172 194 22
5 199 221 22
6 728 750 22
7 762 784 22
8 788 810 22
9 817 839 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1430
MREEPPRTEHQQKETSNRRRCFFFKSSPPSVQRNDIGSDLASVMASSNVLHNCVAFLWGRRQENALWQALLKYAI
AIAIAIALAFLPAFRIASTFLIPMIVAFAHPGQRMGLMIQSLLMVLFGAGLGLSWSLLGLRLALLVGNNTAAAST
IRALFLLVLILVHGYLRSSNPRLMLFVIFLLITAVLTVQLPVTVTGIIFSTAYIPLLVGAGVLLIVNLAIFPELS
SSYLGSTTIDTLSETVDTLTRATNWFVTPGGDPDTVPAEMVHSKTESAKSVKSGAVAKFLSQFPNPFRSAKRGPA
LFSTPHHSTSLSALTEQKPKLRACLAHCKAVQDEVNFEISFSPLPPTALKPISIQYMTGLVRNVTTLIGACENKF
VVVGKNEHSDEKNGAKGKRDKTAGKKSGRRASRRVSRAKHFPSVKPIKEIETSSAELLEAILTRIRGPAQVFQVS
VAESANLVILCLAYCFDVPKLPSGAAAPRTVSLQELDVRIDKFARSLTLFDTEAANQLRENMMDKSYEPVDFMPG
METFMASSFILSLRDSAAQLLEMLRHLRLLVESRQRHHDHSRLWVPQLTIFRQWLAKRRPVKAAEPIELPNITQT
PVEGRVSGPIPAIDHPDARQTPDDEGRIGQTVQWAELKSPKKLKSSKKRARRKSELQNLDWMAKTREKAADALEW
AQKSNDLDYALKLAVAMFLLLWPAFFASWRPWYTQVRGIWAPMQLMLVFEVCIGSSAFGFFLRLIGVVYGCVAGF
AAYEVGRGNRVGVAVVLFVVMMPSIYLHLVAPQYAKVAIVSIVSMSVVALASINGTVPAYEIFYKRLVAFLVGGI
VAMLVEVVIAPVRARDRLVECLSYSVRQIQKMEMTLAVGIEGPWSPNIRSQALLARFNRARDKAHGALADAESAL
PFCLREPRLKGSFKPLAPIYTEITYVLHQIIDRMDNLVQLRRTYGSSILEDLNSKVYAYRRNVAASTTLMLFSIN
EALTTWLPLPQFLPSARLALIRLISRVREIVASDNTSSSPRTELDEETATLITKRKFLSWNAGAVGQIEIVEYLE
ELIELVKLLVGVNGFRSGMLEQSSFGAEVLVQTAREPEPEPSESGGWSPVRWTATTVEAIEECETSSESGSWDEG
IPLSLQRVGTRLRRGSSVVRRRAASTAGIGI*
Coding >Ophun1|1430
ATGCGTGAGGAACCGCCTCGGACCGAACATCAGCAGAAGGAAACCTCGAACCGTCGCCGCTGCTTCTTCTTCAAA
TCCTCCCCTCCGTCCGTCCAACGCAATGATATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAATGTGCTG
CACAACTGCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAATATGCCATC
GCCATCGCCATCGCCATCGCCTTGGCCTTTCTCCCGGCCTTTCGAATCGCCTCGACCTTCCTGATCCCCATGATC
GTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTTGGCGCCGGT
CTCGGCCTGTCTTGGTCTCTTCTGGGCCTTCGACTGGCCTTGCTCGTCGGGAATAATACGGCCGCCGCGAGCACC
ATCCGAGCTCTCTTTCTCCTAGTTCTCATTCTGGTTCACGGCTATCTGCGATCTTCAAACCCTCGGCTCATGCTC
TTCGTCATCTTTCTTCTCATCACGGCCGTCTTGACCGTTCAGCTGCCCGTCACTGTCACGGGCATCATCTTCAGC
ACTGCATACATTCCCTTACTGGTGGGCGCCGGTGTGCTGCTCATCGTCAATCTCGCAATCTTTCCGGAACTCTCC
AGCTCCTACTTGGGCTCTACGACCATTGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACTAATTGG
TTCGTCACCCCCGGTGGTGACCCGGACACTGTCCCAGCCGAGATGGTGCACTCCAAAACCGAATCCGCCAAGTCT
GTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCTAATCCCTTCCGTTCGGCCAAGCGCGGGCCTGCT
CTATTCTCGACGCCTCATCACTCCACCAGTCTGTCTGCCCTGACGGAGCAGAAGCCGAAGCTGCGTGCGTGCCTC
GCTCACTGCAAAGCGGTCCAAGACGAGGTTAACTTTGAGATATCCTTTTCGCCTCTGCCACCGACTGCTCTGAAA
CCCATCAGCATCCAGTACATGACTGGTCTTGTTCGAAACGTGACTACCCTGATTGGCGCTTGCGAGAACAAGTTC
GTCGTTGTGGGCAAGAATGAGCATTCGGACGAGAAGAACGGAGCAAAAGGAAAAAGAGACAAGACAGCAGGGAAG
AAATCAGGCCGGAGAGCTTCAAGAAGAGTGTCCCGCGCGAAGCACTTCCCGAGCGTGAAGCCGATCAAAGAAATC
GAGACGAGCAGCGCCGAACTGCTGGAAGCAATTCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAAGTATCC
GTGGCAGAGTCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCTTCAGGGGCC
GCAGCCCCCAGGACCGTGTCGCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACTCTGTTC
GACACCGAGGCCGCCAATCAGCTCCGAGAGAACATGATGGACAAGTCGTATGAGCCGGTTGACTTTATGCCCGGT
ATGGAGACTTTCATGGCATCGTCTTTCATCCTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAGATGCTCCGT
CATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACCACGACCACTCCAGACTCTGGGTGCCGCAATTGACGATA
TTTCGCCAGTGGCTCGCGAAGCGAAGACCAGTCAAGGCCGCGGAACCCATAGAGTTGCCCAACATCACCCAGACT
CCAGTCGAAGGCCGTGTCTCCGGGCCGATCCCAGCCATTGACCATCCAGATGCCCGTCAAACTCCAGACGACGAG
GGTCGCATTGGTCAAACGGTGCAATGGGCGGAACTCAAGTCACCGAAAAAGCTCAAGTCATCGAAAAAGCGAGCA
CGTCGCAAGTCGGAACTCCAGAATCTCGACTGGATGGCAAAGACGAGGGAAAAGGCGGCCGACGCCCTAGAATGG
GCGCAAAAGTCCAACGACCTGGACTACGCCCTCAAGCTGGCCGTTGCCATGTTTCTGCTCCTCTGGCCCGCCTTC
TTCGCGTCGTGGAGACCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAGTTGATGCTGGTCTTTGAG
GTTTGCATTGGCAGCTCGGCCTTTGGTTTCTTCCTTCGGCTTATCGGCGTTGTCTACGGATGTGTTGCTGGATTT
GCGGCGTATGAGGTTGGGAGAGGTAACCGAGTTGGCGTGGCCGTTGTTCTTTTCGTCGTCATGATGCCGAGCATC
TACCTTCATCTGGTCGCTCCTCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCTGTTGTCGCTCTC
GCCTCGATCAACGGCACTGTCCCCGCCTACGAGATATTCTACAAACGTCTCGTAGCCTTCCTAGTCGGTGGCATC
GTCGCCATGCTAGTCGAGGTCGTCATTGCCCCTGTCCGAGCCAGAGATCGACTAGTCGAGTGCCTCTCTTACTCG
GTCCGACAAATCCAGAAGATGGAAATGACGCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCCAACATCCGCTCG
CAAGCTCTACTCGCCCGCTTCAACCGCGCCCGCGATAAGGCACACGGGGCTCTAGCCGATGCCGAATCGGCACTT
CCGTTCTGCTTGAGAGAGCCGCGTCTTAAGGGAAGCTTCAAGCCGCTGGCGCCCATCTACACGGAGATCACGTAC
GTCCTTCACCAGATCATCGATCGGATGGACAACCTCGTCCAGCTACGGAGAACATACGGCTCCTCTATTCTCGAA
GACCTGAATTCAAAGGTGTACGCCTACAGGAGGAACGTGGCAGCCAGCACGACACTAATGCTCTTCTCCATCAAC
GAGGCCCTCACCACCTGGCTCCCTCTCCCCCAGTTCCTCCCCTCAGCCCGCCTGGCCCTCATCCGCCTCATCAGC
CGCGTCCGCGAAATCGTCGCCTCAGACAACACATCGTCCAGCCCGCGCACCGAACTAGACGAAGAGACGGCAACC
CTCATCACCAAGCGCAAGTTCCTCTCCTGGAACGCCGGCGCCGTCGGCCAGATCGAAATCGTAGAATACCTCGAA
GAGCTCATCGAGCTCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAAGCGGCATGCTCGAGCAGTCGTCGTTT
GGGGCAGAGGTGCTGGTGCAGACGGCGCGCGAGCCGGAGCCGGAGCCGAGTGAAAGCGGTGGCTGGTCTCCCGTA
CGCTGGACGGCGACGACGGTGGAGGCTATTGAAGAGTGTGAGACGAGTTCTGAGAGTGGGAGTTGGGATGAGGGC
ATTCCGCTTAGCCTGCAGAGGGTTGGGACTCGTTTGAGGAGGGGGAGTTCTGTGGTGAGGCGGAGAGCGGCGTCT
ACGGCTGGGATTGGGATTTGA
Transcript >Ophun1|1430
ATGCGTGAGGAACCGCCTCGGACCGAACATCAGCAGAAGGAAACCTCGAACCGTCGCCGCTGCTTCTTCTTCAAA
TCCTCCCCTCCGTCCGTCCAACGCAATGATATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAATGTGCTG
CACAACTGCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAATATGCCATC
GCCATCGCCATCGCCATCGCCTTGGCCTTTCTCCCGGCCTTTCGAATCGCCTCGACCTTCCTGATCCCCATGATC
GTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTTGGCGCCGGT
CTCGGCCTGTCTTGGTCTCTTCTGGGCCTTCGACTGGCCTTGCTCGTCGGGAATAATACGGCCGCCGCGAGCACC
ATCCGAGCTCTCTTTCTCCTAGTTCTCATTCTGGTTCACGGCTATCTGCGATCTTCAAACCCTCGGCTCATGCTC
TTCGTCATCTTTCTTCTCATCACGGCCGTCTTGACCGTTCAGCTGCCCGTCACTGTCACGGGCATCATCTTCAGC
ACTGCATACATTCCCTTACTGGTGGGCGCCGGTGTGCTGCTCATCGTCAATCTCGCAATCTTTCCGGAACTCTCC
AGCTCCTACTTGGGCTCTACGACCATTGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACTAATTGG
TTCGTCACCCCCGGTGGTGACCCGGACACTGTCCCAGCCGAGATGGTGCACTCCAAAACCGAATCCGCCAAGTCT
GTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCTAATCCCTTCCGTTCGGCCAAGCGCGGGCCTGCT
CTATTCTCGACGCCTCATCACTCCACCAGTCTGTCTGCCCTGACGGAGCAGAAGCCGAAGCTGCGTGCGTGCCTC
GCTCACTGCAAAGCGGTCCAAGACGAGGTTAACTTTGAGATATCCTTTTCGCCTCTGCCACCGACTGCTCTGAAA
CCCATCAGCATCCAGTACATGACTGGTCTTGTTCGAAACGTGACTACCCTGATTGGCGCTTGCGAGAACAAGTTC
GTCGTTGTGGGCAAGAATGAGCATTCGGACGAGAAGAACGGAGCAAAAGGAAAAAGAGACAAGACAGCAGGGAAG
AAATCAGGCCGGAGAGCTTCAAGAAGAGTGTCCCGCGCGAAGCACTTCCCGAGCGTGAAGCCGATCAAAGAAATC
GAGACGAGCAGCGCCGAACTGCTGGAAGCAATTCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAAGTATCC
GTGGCAGAGTCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCTTCAGGGGCC
GCAGCCCCCAGGACCGTGTCGCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACTCTGTTC
GACACCGAGGCCGCCAATCAGCTCCGAGAGAACATGATGGACAAGTCGTATGAGCCGGTTGACTTTATGCCCGGT
ATGGAGACTTTCATGGCATCGTCTTTCATCCTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAGATGCTCCGT
CATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACCACGACCACTCCAGACTCTGGGTGCCGCAATTGACGATA
TTTCGCCAGTGGCTCGCGAAGCGAAGACCAGTCAAGGCCGCGGAACCCATAGAGTTGCCCAACATCACCCAGACT
CCAGTCGAAGGCCGTGTCTCCGGGCCGATCCCAGCCATTGACCATCCAGATGCCCGTCAAACTCCAGACGACGAG
GGTCGCATTGGTCAAACGGTGCAATGGGCGGAACTCAAGTCACCGAAAAAGCTCAAGTCATCGAAAAAGCGAGCA
CGTCGCAAGTCGGAACTCCAGAATCTCGACTGGATGGCAAAGACGAGGGAAAAGGCGGCCGACGCCCTAGAATGG
GCGCAAAAGTCCAACGACCTGGACTACGCCCTCAAGCTGGCCGTTGCCATGTTTCTGCTCCTCTGGCCCGCCTTC
TTCGCGTCGTGGAGACCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAGTTGATGCTGGTCTTTGAG
GTTTGCATTGGCAGCTCGGCCTTTGGTTTCTTCCTTCGGCTTATCGGCGTTGTCTACGGATGTGTTGCTGGATTT
GCGGCGTATGAGGTTGGGAGAGGTAACCGAGTTGGCGTGGCCGTTGTTCTTTTCGTCGTCATGATGCCGAGCATC
TACCTTCATCTGGTCGCTCCTCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCTGTTGTCGCTCTC
GCCTCGATCAACGGCACTGTCCCCGCCTACGAGATATTCTACAAACGTCTCGTAGCCTTCCTAGTCGGTGGCATC
GTCGCCATGCTAGTCGAGGTCGTCATTGCCCCTGTCCGAGCCAGAGATCGACTAGTCGAGTGCCTCTCTTACTCG
GTCCGACAAATCCAGAAGATGGAAATGACGCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCCAACATCCGCTCG
CAAGCTCTACTCGCCCGCTTCAACCGCGCCCGCGATAAGGCACACGGGGCTCTAGCCGATGCCGAATCGGCACTT
CCGTTCTGCTTGAGAGAGCCGCGTCTTAAGGGAAGCTTCAAGCCGCTGGCGCCCATCTACACGGAGATCACGTAC
GTCCTTCACCAGATCATCGATCGGATGGACAACCTCGTCCAGCTACGGAGAACATACGGCTCCTCTATTCTCGAA
GACCTGAATTCAAAGGTGTACGCCTACAGGAGGAACGTGGCAGCCAGCACGACACTAATGCTCTTCTCCATCAAC
GAGGCCCTCACCACCTGGCTCCCTCTCCCCCAGTTCCTCCCCTCAGCCCGCCTGGCCCTCATCCGCCTCATCAGC
CGCGTCCGCGAAATCGTCGCCTCAGACAACACATCGTCCAGCCCGCGCACCGAACTAGACGAAGAGACGGCAACC
CTCATCACCAAGCGCAAGTTCCTCTCCTGGAACGCCGGCGCCGTCGGCCAGATCGAAATCGTAGAATACCTCGAA
GAGCTCATCGAGCTCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAAGCGGCATGCTCGAGCAGTCGTCGTTT
GGGGCAGAGGTGCTGGTGCAGACGGCGCGCGAGCCGGAGCCGGAGCCGAGTGAAAGCGGTGGCTGGTCTCCCGTA
CGCTGGACGGCGACGACGGTGGAGGCTATTGAAGAGTGTGAGACGAGTTCTGAGAGTGGGAGTTGGGATGAGGGC
ATTCCGCTTAGCCTGCAGAGGGTTGGGACTCGTTTGAGGAGGGGGAGTTCTGTGGTGAGGCGGAGAGCGGCGTCT
ACGGCTGGGATTGGGATTTGA
Gene >Ophun1|1430
ATGCGTGAGGAACCGCCTCGGACCGAACATCAGCAGAAGGAAACCTCGAACCGTCGCCGCTGCTTCTTCTTCAAA
TCCTCCCCTCCGTCCGTCCAACGCAATGATATCGGATCCGATCTCGCGTCCGTCATGGCGTCTTCAAATGTGCTG
CACAACTGCGTCGCCTTTCTCTGGGGCCGTCGTCAGGAGAATGCCTTGTGGCAGGCTTTGCTCAAATATGCCATC
GCCATCGCCATCGCCATCGCCTTGGCCTTTCTCCCGGCCTTTCGAATCGCCTCGACCTTCCTGATCCCCATGATC
GTCGCCTTTGCACATCCCGGCCAGAGGATGGGCTTGATGATCCAATCGCTGCTCATGGTGCTTTTTGGCGCCGGT
CTCGGCCTGTCTTGGTCTCTTCTGGGCCTTCGACTGGCCTTGCTCGTCGGGAATAATACGGCCGCCGCGAGCACC
ATCCGAGCTCTCTTTCTCCTAGTTCTCATTCTGGTTCACGGCTATCTGCGATCTTCAAACCCTCGGCTCATGCTC
TTCGTCATCTTTCTTCTCATCACGGCCGTCTTGACCGTTCAGCTGCCCGTCACTGTCACGGGCATCATCTTCAGC
ACTGCATACATTCCCTTACTGGTGGGCGCCGGTGTGCTGCTCATCGTCAATCTCGCAATCTTTCCGGAACTCTCC
AGCTCCTACTTGGGCTCTACGACCATTGATACGCTGTCGGAGACGGTCGACACATTGACGCGGGCAACTAATTGG
TTCGTCACCCCCGGTGGTGACCCGGACACTGTCCCAGCCGAGATGGTGCACTCCAAAACCGAATCCGCCAAGTCT
GTCAAATCGGGAGCCGTTGCCAAGTTCTTGTCACAGTTTCCTAATCCCTTCCGTTCGGCCAAGCGCGGGCCTGCT
CTATTCTCGACGCCTCATCACTCCACCAGTCTGTCTGCCCTGACGGAGCAGAAGCCGAAGCTGCGTGCGTGCCTC
GCTCACTGCAAAGCGGTCCAAGACGAGGTTAACTTTGAGATATCCTTTTCGCCTCTGCCACCGACTGCTCTGAAA
CCCATCAGCATCCAGTACATGACTGGTCTTGTTCGAAACGTGACTACCCTGATTGGCGCTTGCGAGAACAAGTTC
GTCGTTGTGGGCAAGAATGAGCATTCGGACGAGAAGAACGGAGCAAAAGGAAAAAGAGACAAGACAGCAGGGAAG
AAATCAGGCCGGAGAGCTTCAAGAAGAGTGTCCCGCGCGAAGCACTTCCCGAGCGTGAAGCCGATCAAAGAAATC
GAGACGAGCAGCGCCGAACTGCTGGAAGCAATTCTCACACGCATTCGAGGTCCCGCTCAGGTTTTCCAAGTATCC
GTGGCAGAGTCGGCCAATCTCGTCATCCTGTGTCTCGCCTACTGCTTCGACGTGCCGAAGCTTCCTTCAGGGGCC
GCAGCCCCCAGGACCGTGTCGCTGCAGGAGCTTGACGTTAGAATCGACAAGTTTGCCCGCTCGCTGACTCTGTTC
GACACCGAGGCCGCCAATCAGCTCCGAGAGAACATGATGGACAAGTCGTATGAGCCGGTTGACTTTATGCCCGGT
ATGGAGACTTTCATGGCATCGTCTTTCATCCTGTCTCTTCGGGACTCTGCGGCGCAACTGTTGGAGATGCTCCGT
CATTTGCGGCTTCTCGTCGAGAGCAGACAGCGTCACCACGACCACTCCAGACTCTGGGTGCCGCAATTGACGATA
TTTCGCCAGTGGCTCGCGAAGCGAAGACCAGTCAAGGCCGCGGAACCCATAGAGTTGCCCAACATCACCCAGACT
CCAGTCGAAGGCCGTGTCTCCGGGCCGATCCCAGCCATTGACCATCCAGATGCCCGTCAAACTCCAGACGACGAG
GGTCGCATTGGTCAAACGGTGCAATGGGCGGAACTCAAGTCACCGAAAAAGCTCAAGTCATCGAAAAAGCGAGCA
CGTCGCAAGTCGGAACTCCAGAATCTCGACTGGATGGCAAAGACGAGGGAAAAGGCGGCCGACGCCCTAGAATGG
GCGCAAAAGTCCAACGACCTGGACTACGCCCTCAAGCTGGCCGTTGCCATGTTTCTGCTCCTCTGGCCCGCCTTC
TTCGCGTCGTGGAGACCGTGGTATACGCAGGTTCGTGGCATCTGGGCGCCCATGCAGTTGATGCTGGTCTTTGAG
GTTTGCATTGGCAGCTCGGCCTTTGGTTTCTTCCTTCGGCTTATCGGCGTTGTCTACGGATGTGTTGCTGGATTT
GCGGCGTATGAGGTTGGGAGAGGTAACCGAGTTGGCGTGGCCGTTGTTCTTTTCGTCGTCATGATGCCGAGCATC
TACCTTCATCTGGTCGCTCCTCAGTATGCCAAGGTGGCTATCGTCTCCATCGTGTCCATGTCTGTTGTCGCTCTC
GGTAAGTCAGAAGATCATCTGCCAGTGGCACGGAATGAAGCTGACGGTCATATTCCATGCCAGCCTCGATCAACG
GCACTGTCCCCGCCTACGAGATATTCTACAAACGTCTCGTAGCCTTCCTAGTCGGTGGCATCGTCGCCATGCTAG
TCGAGGTCGTCATTGCCCCTGTCCGAGCCAGAGATCGACTAGTCGAGTGCCTCTCTTACTCGGTCCGACAAATCC
AGAAGATGGAAATGACGCTCGCTGTCGGCATCGAAGGGCCTTGGAGTCCCAACATCCGCTCGCAAGCTCTACTCG
CCCGCTTCAACCGCGCCCGCGATAAGGCACACGGGGCTCTAGCCGATGCCGAATCGGCACTTCCGTTCTGCTTGA
GAGAGCCGCGTCTTAAGGGAAGCTTCAAGCCGCTGGCGCCCATCTACACGGAGATCACGTACGTCCTTCACCAGA
TCATCGATCGGATGGACAACCTCGTCCAGCTACGGAGAACATACGGCTCCTCTATTCTCGAAGACCTGAATTCAA
AGGTGTACGCCTACAGGAGGAACGTGGCAGCCAGCACGACACTAATGCTCTTCTCCATCAACGAGGCCCTCACCA
CCTGGCTCCCTCTCCCCCAGTTCCTCCCCTCAGCCCGCCTGGCCCTCATCCGCCTCATCAGCCGCGTCCGCGAAA
TCGTCGCCTCAGACAACACATCGTCCAGCCCGCGCACCGAACTAGACGAAGAGACGGCAACCCTCATCACCAAGC
GCAAGTTCCTCTCCTGGAACGCCGGCGCCGTCGGCCAGATCGAAATCGTAGAATACCTCGAAGAGCTCATCGAGC
TCGTCAAGCTCCTCGTCGGCGTCAACGGCTTCCGAAGCGGCATGCTCGAGCAGTCGTCGTTTGGGGCAGAGGTGC
TGGTGCAGACGGCGCGCGAGCCGGAGCCGGAGCCGAGTGAAAGCGGTGGCTGGTCTCCCGTACGCTGGACGGCGA
CGACGGTGGAGGCTATTGAAGAGTGTGAGACGAGTTCTGAGAGTGGGAGTTGGGATGAGGGCATTCCGCTTAGCC
TGCAGAGGGTTGGGACTCGTTTGAGGAGGGGGAGTTCTGTGGTGAGGCGGAGAGCGGCGTCTACGGCTGGGATTG
GGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail