Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1423
Gene name
LocationContig_158:9145..9905
Strand-
Gene length (bp)760
Transcript length (bp)252
Coding sequence length (bp)252
Protein length (aa) 84

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01667 Ribosomal_S27e Ribosomal protein S27 5.0E-28 29 83

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN2|RS27_NEUCR 40S ribosomal protein S27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-6 PE=3 SV=1 3 83 4.0E-52
sp|O74330|RS27_SCHPO 40S ribosomal protein S27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps27 PE=3 SV=1 3 83 4.0E-43
sp|P38711|RS27B_YEAST 40S ribosomal protein S27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27B PE=1 SV=1 3 83 2.0E-38
sp|P55833|RS27_HOMAM 40S ribosomal protein S27 OS=Homarus americanus GN=RPS27 PE=3 SV=2 4 83 3.0E-38
sp|P35997|RS27_YEAST 40S ribosomal protein S27-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27A PE=1 SV=1 3 83 3.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RVN2|RS27_NEUCR 40S ribosomal protein S27 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crp-6 PE=3 SV=1 3 83 4.0E-52
sp|O74330|RS27_SCHPO 40S ribosomal protein S27 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rps27 PE=3 SV=1 3 83 4.0E-43
sp|P38711|RS27B_YEAST 40S ribosomal protein S27-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27B PE=1 SV=1 3 83 2.0E-38
sp|P55833|RS27_HOMAM 40S ribosomal protein S27 OS=Homarus americanus GN=RPS27 PE=3 SV=2 4 83 3.0E-38
sp|P35997|RS27_YEAST 40S ribosomal protein S27-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS27A PE=1 SV=1 3 83 3.0E-38
sp|Q9M2F1|RS272_ARATH 40S ribosomal protein S27-2 OS=Arabidopsis thaliana GN=RPS27B PE=2 SV=2 6 83 7.0E-38
sp|Q8L953|RS273_ARATH 40S ribosomal protein S27-3 OS=Arabidopsis thaliana GN=RPS27D PE=2 SV=2 6 83 2.0E-37
sp|O64650|RS271_ARATH 40S ribosomal protein S27-1 OS=Arabidopsis thaliana GN=RPS27A PE=3 SV=1 6 83 6.0E-36
sp|Q9TXP0|RS27_CAEEL 40S ribosomal protein S27 OS=Caenorhabditis elegans GN=rps-27 PE=1 SV=3 4 83 1.0E-35
sp|Q71TY3|RS27_RAT 40S ribosomal protein S27 OS=Rattus norvegicus GN=Rps27 PE=1 SV=3 4 83 1.0E-35
sp|Q6ZWU9|RS27_MOUSE 40S ribosomal protein S27 OS=Mus musculus GN=Rps27 PE=1 SV=3 4 83 1.0E-35
sp|P42677|RS27_HUMAN 40S ribosomal protein S27 OS=Homo sapiens GN=RPS27 PE=1 SV=3 4 83 1.0E-35
sp|Q2KHT7|RS27_BOVIN 40S ribosomal protein S27 OS=Bos taurus GN=RPS27 PE=3 SV=3 4 83 1.0E-35
sp|P47904|RS27_XENLA 40S ribosomal protein S27 OS=Xenopus laevis GN=rps27 PE=3 SV=2 4 83 4.0E-35
sp|Q3T0B7|RS27L_BOVIN 40S ribosomal protein S27-like OS=Bos taurus GN=RPS27L PE=3 SV=3 4 83 4.0E-35
sp|Q5RBK1|RS27_PONAB 40S ribosomal protein S27 OS=Pongo abelii GN=RPS27 PE=3 SV=3 4 83 2.0E-34
sp|P24051|RS27L_RAT 40S ribosomal protein S27-like OS=Rattus norvegicus GN=Rps27l PE=1 SV=3 4 83 5.0E-34
sp|Q6ZWY3|RS27L_MOUSE 40S ribosomal protein S27-like OS=Mus musculus GN=Rps27l PE=1 SV=3 4 83 5.0E-34
sp|Q71UM5|RS27L_HUMAN 40S ribosomal protein S27-like OS=Homo sapiens GN=RPS27L PE=1 SV=3 4 83 5.0E-34
sp|Q96564|RS27_HORVU 40S ribosomal protein S27 OS=Hordeum vulgare GN=RPS27 PE=3 SV=2 6 83 6.0E-33
sp|P47903|RS27_CHLRE 40S ribosomal protein S27 OS=Chlamydomonas reinhardtii GN=RPS27 PE=3 SV=1 6 83 5.0E-32
sp|Q8T1V4|RS27_DICDI 40S ribosomal protein S27 OS=Dictyostelium discoideum GN=rps27 PE=3 SV=2 7 83 8.0E-32
sp|P38654|RS27_ENTHI 40S ribosomal protein S27 OS=Entamoeba histolytica GN=RPS27 PE=3 SV=1 1 83 2.0E-26
sp|B1YAF9|RS27_PYRNV 30S ribosomal protein S27e OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rps27e PE=3 SV=1 23 75 9.0E-13
sp|A1RRN0|RS27_PYRIL 30S ribosomal protein S27e OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rps27e PE=3 SV=1 23 75 2.0E-12
sp|A4WLR8|RS27_PYRAR 30S ribosomal protein S27e OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rps27e PE=3 SV=1 23 75 1.0E-10
sp|Q973F9|RS27_SULTO 30S ribosomal protein S27e OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rps27e PE=3 SV=1 19 74 1.0E-10
sp|A3MUV2|RS27_PYRCJ 30S ribosomal protein S27e OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rps27e PE=3 SV=1 23 72 9.0E-10
sp|Q97Z80|RS27_SULSO 30S ribosomal protein S27e OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rps27e PE=3 SV=1 21 75 1.0E-09
sp|Q9YF01|RS27_AERPE 30S ribosomal protein S27e OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rps27e PE=3 SV=1 21 74 2.0E-09
sp|Q8ZTY4|RS27_PYRAE 30S ribosomal protein S27e OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rps27e PE=3 SV=1 23 74 4.0E-09
sp|A2BN94|RS27_HYPBU 30S ribosomal protein S27e OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rps27e PE=3 SV=1 21 74 1.0E-08
sp|Q8TY87|RS27_METKA 30S ribosomal protein S27e OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rps27e PE=3 SV=1 18 74 4.0E-08
sp|C5A6X9|RS27_THEGJ 30S ribosomal protein S27e OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rps27e PE=3 SV=1 23 72 5.0E-08
sp|Q5JE50|RS27_THEKO 30S ribosomal protein S27e OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rps27e PE=3 SV=1 23 72 7.0E-08
sp|A7I9Q6|RS27_METB6 30S ribosomal protein S27e OS=Methanoregula boonei (strain 6A8) GN=rps27e PE=3 SV=1 28 74 1.0E-07
sp|Q9UXZ3|RS27_PYRAB 30S ribosomal protein S27e OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rps27e PE=3 SV=1 23 72 1.0E-07
sp|Q8U474|RS27_PYRFU 30S ribosomal protein S27e OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rps27e PE=1 SV=1 23 72 3.0E-07
sp|B6YT34|RS27_THEON 30S ribosomal protein S27e OS=Thermococcus onnurineus (strain NA1) GN=rps27e PE=3 SV=1 23 72 3.0E-07
sp|P58078|RS27_PYRHO 30S ribosomal protein S27e OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rps27e PE=3 SV=1 23 72 3.0E-07
sp|P54028|RS27_METJA 30S ribosomal protein S27e OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rps27e PE=3 SV=1 22 74 3.0E-07
sp|A2ST12|RS27_METLZ 30S ribosomal protein S27e OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rps27e PE=3 SV=1 30 74 5.0E-07
sp|Q4J9B1|RS27_SULAC 30S ribosomal protein S27e OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rps27e PE=3 SV=1 19 81 7.0E-07
sp|A3CX76|RS27_METMJ 30S ribosomal protein S27e OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rps27e PE=3 SV=1 30 74 8.0E-07
sp|B8GGQ3|RS27_METPE 30S ribosomal protein S27e OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rps27e PE=3 SV=1 25 74 3.0E-06
sp|Q9HRT7|RS27_HALSA 30S ribosomal protein S27e OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rps27e PE=3 SV=1 33 74 9.0E-06
sp|B0R3M1|RS27_HALS3 30S ribosomal protein S27e OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rps27e PE=3 SV=1 33 74 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1423
MRVLAVDLLNPSPAAEARKYKLKTLVPAPRSFFMDVKCPGCFTITTVFSHAQTVVICQGCTTVLCQPTGGKARLT
EGCSFRRK*
Coding >Ophun1|1423
ATGCGGGTTCTCGCCGTCGATCTTCTCAACCCTTCGCCGGCTGCCGAGGCCAGAAAGTACAAGCTCAAGACGCTG
GTGCCCGCCCCCCGGTCCTTCTTCATGGACGTCAAGTGCCCCGGCTGCTTCACCATCACCACCGTCTTCTCGCAC
GCGCAGACGGTTGTCATCTGCCAGGGTTGCACCACGGTGCTGTGCCAGCCGACAGGCGGCAAGGCCAGATTAACC
GAGGGCTGCTCGTTCCGGAGAAAGTAA
Transcript >Ophun1|1423
ATGCGGGTTCTCGCCGTCGATCTTCTCAACCCTTCGCCGGCTGCCGAGGCCAGAAAGTACAAGCTCAAGACGCTG
GTGCCCGCCCCCCGGTCCTTCTTCATGGACGTCAAGTGCCCCGGCTGCTTCACCATCACCACCGTCTTCTCGCAC
GCGCAGACGGTTGTCATCTGCCAGGGTTGCACCACGGTGCTGTGCCAGCCGACAGGCGGCAAGGCCAGATTAACC
GAGGGCTGCTCGTTCCGGAGAAAGTAA
Gene >Ophun1|1423
ATGCGGGTACGTACCGCGGTTGGGCGGGTAACGGCACAGCCAATCAAAAGAGCAGAATTTAGTCACGTGTAATTG
GGCCTGTAAGCCCTACTGCGCTAGTCTGTTTCAGACCAGTTTTCCCAGCCGGAGGCGAAAGGGCGTGAAACTTTT
ACTCTTCAACTCCTCTTCATCTTGCGAGCCCTGAATCTGCAGACAGATTTCGACAAGCATCTCCATCCTCGCAAG
ATACCGACTGCCTCACGCTATCGATACACACTGTCAAAATGGTGAGCGGCCAACGACACCTTACCTGCTCTCTGC
GCGGACGAAACATGGGTCGGGATTTGTGCGGAGCGGCGATGGCCAACGAGACATTGGCCGTGCCTCTGAACGAAC
GCCAAATTTCAGCGATGGACTCGAGCCCGGCTGAAGGAAGCGATTGATGCGTGAACTAGCCTTGCTAACGTTGTG
CTCTCCGTAGGTTCTCGCCGTCGATCTTCTCAACCCTTCGCCGGCTGCCGAGGCCAGAAAGTACAAGCTCAAGGT
ACGAGGTCGATGAGCAGCGCGCGAAGGACAATGCCTAATTCAGACGCCGCAGACGCTGGTGCCCGCCCCCCGGTC
CTTCTTCATGGACGTCAAGTGCCCCGGCTGCTTCACCATCACCACCGTCTTCTCGCACGCGCAGACGGTTGTCAT
CTGCCAGGGTTGCACCACGGTGCTGTGCCAGCCGACAGGCGGCAAGGCCAGATTAACCGAGGGCTGCTCGTTCCG
GAGAAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail