Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1409
Gene name
LocationContig_157:19517..23617
Strand+
Gene length (bp)4100
Transcript length (bp)3390
Coding sequence length (bp)3390
Protein length (aa) 1130

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04106 APG5 Autophagy protein Apg5 6.6E-42 966 1128
PF00168 C2 C2 domain 3.6E-14 34 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HGZ8|ATG5_CHAGB Autophagy protein 5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG5 PE=3 SV=1 879 1129 3.0E-104
sp|Q872C6|ATG5_NEUCR Autophagy-related protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-4 PE=3 SV=3 881 1129 3.0E-99
sp|Q525E4|ATG5_MAGO7 Autophagy protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG5 PE=2 SV=1 878 1128 1.0E-81
sp|A7EJG6|ATG5_SCLS1 Autophagy protein 5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg5 PE=3 SV=1 883 1129 5.0E-79
sp|A1CE93|ATG5_ASPCL Autophagy protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg5 PE=3 SV=2 875 1127 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HGZ8|ATG5_CHAGB Autophagy protein 5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=ATG5 PE=3 SV=1 879 1129 3.0E-104
sp|Q872C6|ATG5_NEUCR Autophagy-related protein 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-4 PE=3 SV=3 881 1129 3.0E-99
sp|Q525E4|ATG5_MAGO7 Autophagy protein 5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG5 PE=2 SV=1 878 1128 1.0E-81
sp|A7EJG6|ATG5_SCLS1 Autophagy protein 5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=atg5 PE=3 SV=1 883 1129 5.0E-79
sp|A1CE93|ATG5_ASPCL Autophagy protein 5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=atg5 PE=3 SV=2 875 1127 1.0E-43
sp|A7KAL6|ATG5_PENRW Autophagy protein 5 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=atg5 PE=3 SV=1 874 1127 1.0E-42
sp|Q4WNA5|ATG5_ASPFU Autophagy protein 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=atg5 PE=3 SV=1 874 1127 4.0E-41
sp|A1DMA1|ATG5_NEOFI Autophagy protein 5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=atg5 PE=3 SV=1 875 1127 8.0E-41
sp|Q0CRF3|ATG5_ASPTN Autophagy protein 5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=atg5 PE=3 SV=2 879 1127 1.0E-40
sp|Q5B2Q6|ATG5_EMENI Autophagy protein 5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=atg5 PE=3 SV=2 877 1127 5.0E-40
sp|Q2UBM1|ATG5_ASPOR Autophagy protein 5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=atg5 PE=3 SV=1 877 1127 2.0E-39
sp|Q0UXN8|ATG5_PHANO Autophagy protein 5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=ATG5 PE=3 SV=1 881 1129 5.0E-38
sp|A6RE26|ATG5_AJECN Autophagy protein 5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=ATG5 PE=3 SV=1 875 1127 3.0E-37
sp|Q1DP17|ATG5_COCIM Autophagy protein 5 OS=Coccidioides immitis (strain RS) GN=ATG5 PE=3 SV=1 879 1127 4.0E-27
sp|O74971|ATG5_SCHPO Autophagy protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atg5 PE=1 SV=1 877 1128 3.0E-21
sp|O94701|INN1_SCHPO Ingression protein fic1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fic1 PE=1 SV=1 33 167 7.0E-19
sp|Q6C4Q6|ATG5_YARLI Autophagy protein 5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ATG5 PE=3 SV=2 968 1129 2.0E-18
sp|A7KAI4|ATG5_PICAN Autophagy protein 5 OS=Pichia angusta GN=ATG5 PE=3 SV=1 903 1123 3.0E-12
sp|A3LR68|ATG5_PICST Autophagy protein 5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ATG5 PE=3 SV=2 879 1128 4.0E-12
sp|Q3MQ06|ATG5_RAT Autophagy protein 5 OS=Rattus norvegicus GN=Atg5 PE=2 SV=1 873 1128 1.0E-11
sp|A7TS83|ATG5_VANPO Autophagy protein 5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=ATG5 PE=3 SV=1 977 1127 2.0E-11
sp|Q99J83|ATG5_MOUSE Autophagy protein 5 OS=Mus musculus GN=Atg5 PE=1 SV=1 873 1128 3.0E-11
sp|Q3MQ24|ATG5_BOVIN Autophagy protein 5 OS=Bos taurus GN=ATG5 PE=2 SV=2 873 1128 1.0E-10
sp|Q3MQ04|ATG5_PIG Autophagy protein 5 OS=Sus scrofa GN=ATG5 PE=2 SV=1 873 1128 2.0E-10
sp|Q9H1Y0|ATG5_HUMAN Autophagy protein 5 OS=Homo sapiens GN=ATG5 PE=1 SV=2 873 1128 3.0E-10
sp|Q5R792|ATG5_PONAB Autophagy protein 5 OS=Pongo abelii GN=ATG5 PE=2 SV=1 873 1128 4.0E-10
sp|Q6BVI8|ATG5_DEBHA Autophagy protein 5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ATG5 PE=3 SV=2 879 1100 7.0E-10
sp|Q9FFI2|ATG5_ARATH Autophagy protein 5 OS=Arabidopsis thaliana GN=ATG5 PE=2 SV=1 881 1020 2.0E-09
sp|Q59VY1|ATG5_CANAL Autophagy protein 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ATG5 PE=3 SV=1 877 1040 4.0E-09
sp|A2X052|ATG5_ORYSI Autophagy protein 5 OS=Oryza sativa subsp. indica GN=ATG5 PE=3 SV=2 909 1024 3.0E-07
sp|P0CM36|ATG5_CRYNJ Autophagy protein 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ATG5 PE=3 SV=1 972 1123 3.0E-07
sp|P0CM37|ATG5_CRYNB Autophagy protein 5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ATG5 PE=3 SV=1 972 1123 3.0E-07
sp|Q6ZGL4|ATG5_ORYSJ Autophagy protein 5 OS=Oryza sativa subsp. japonica GN=ATG5 PE=2 SV=1 909 1024 4.0E-07
sp|A5DCZ3|ATG5_PICGU Autophagy protein 5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ATG5 PE=3 SV=2 883 1128 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005737 cytoplasm Yes
GO:0006914 autophagy Yes
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0044248 cellular catabolic process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:0061919 process utilizing autophagic mechanism No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1409
MATMAAPKPKSYALNGGHTAGIFADMSVDGPQIGTLVMVVDRAKNLPNRKTIGKQDPYCAARLGKEAKKTATDIR
GGQTPKWDQELRFTVHDSPDYYQLKMSVFTDDKKTELIGDAWIDLKGIVVPGGGQSDMWQSLACKNKYAGEIRVE
ITYYDSRPKPDKPAASKRRQHHAQAQPQQSPPMVPDQDTMLRTPVKRRPLPSDPVTGEAPSPQSIGNASPEPLHQ
TSPRPHVFVPTQSPLQAVEYNTPARQLSDPYSPSQPAGRVDGPRPVHRARNMSDSSSPRLYDDRGHVQKGPVSPY
DRGHHSPLPDHYHEMPAREEPRMDDQMPENACPPPPPAHRSMPSGDSQELVHRGSYEATPQKTPTSTPMRHEVLR
NEAHRYSAPSHPGRPIFKPYVPPSSDHRDASPLDSAPRYHSYDAADDAYYRPMQATVEDAPESPPGVQHASYGHV
VAAMSRPHDDEMMFDVPPRTESMDLRTSPGPSHHASYSNGRYYQEDNLAEHAQSPPYHIRSPQRHERVPHDGFGS
RYDLPDVPASLSPGLDPNLSREISEQMLEERRSMARHSPPPLSTPTRGHHKEKAASVSYSPYAAGYTARPYECRP
EAADNQLVRQGDAGRNARYSIPRKSVSPGPPLAENRLLADTPYSPDSYDALNPGLRAGGPDNERVEVEGKIILHD
GREVDPSDHLPMESWAPEPEPKYQTPTKPPPEQRTRPSPSGAQPMPPSGRRPLRIAAAQPNMVTPPPPHKLPDSP
YTASPRGGGGGRGRLQKKTDRGSPWAHSWTGSSPLAPVSTDKLQGRQGRFTPGSDGVPRWGSWDCSIENHPQQDM
SPQAHGKMGFPMMNEGGHVDVALMREMQGIDIGSAASQDGDSGPAKAMTSPGSIPQTLWDSRIPLLIQHATRPSA
TPFVTSVPRFSYLALLLPRLTAFFGAPCSSFHFEEVQLRNLAAGLLVDLYRPSWPWRLTVGDGVGWDIADTFLNC
VKEADFIRNGNANQIMKMSKDHTTQLWNAVIDNDYASWLQVQTRLLNAPTTLKHVPLRVYIPSPPPGPEPNLEPD
TGSFKVIQSLIAAVGPDRRPTLLGQALKATMPKLFPSSRDPVLASVVLHGAPAPFDAPLAELMREAAYPDGWLCL
VVVV*
Coding >Ophun1|1409
ATGGCGACGATGGCGGCTCCCAAGCCCAAGTCGTACGCCCTCAACGGCGGACATACTGCGGGCATCTTCGCTGAC
ATGTCCGTCGACGGGCCGCAGATTGGCACTCTCGTCATGGTCGTCGATCGGGCCAAGAACCTGCCCAACAGAAAG
ACCATTGGCAAGCAGGATCCTTATTGTGCTGCCAGGCTGGGAAAGGAGGCCAAGAAGACGGCTACAGATATTCGC
GGTGGCCAGACGCCCAAATGGGATCAAGAGCTGCGCTTCACTGTCCACGACTCGCCCGACTACTACCAGCTCAAA
ATGTCCGTCTTCACCGACGACAAGAAGACGGAACTGATTGGCGATGCCTGGATCGACCTCAAGGGCATCGTCGTT
CCTGGCGGCGGCCAGAGCGACATGTGGCAGAGCCTCGCGTGCAAGAACAAATATGCCGGCGAGATTCGCGTCGAG
ATCACCTACTACGACAGCCGGCCCAAGCCCGACAAGCCAGCTGCCTCCAAGCGCAGACAGCACCACGCTCAAGCG
CAGCCCCAGCAGTCGCCGCCCATGGTGCCTGACCAGGACACAATGTTGCGGACGCCAGTCAAGAGACGACCTCTG
CCATCGGATCCCGTCACAGGCGAGGCTCCGTCTCCTCAGTCGATTGGCAACGCCTCACCGGAGCCCCTTCACCAG
ACGTCCCCTCGACCTCACGTCTTTGTTCCGACGCAGTCGCCTCTGCAGGCAGTCGAGTATAATACACCTGCTCGA
CAGCTATCGGACCCGTACTCGCCATCTCAACCCGCCGGTCGTGTGGACGGCCCTCGCCCGGTGCATCGGGCTAGG
AACATGTCGGACTCCTCGTCACCACGTCTGTATGACGATAGGGGTCACGTTCAGAAAGGGCCCGTCTCGCCGTAC
GACCGTGGCCACCACTCTCCACTGCCGGACCACTACCACGAGATGCCAGCGCGGGAGGAGCCCAGGATGGACGAC
CAGATGCCAGAAAACGCATGTCCGCCGCCTCCTCCGGCTCATCGTTCCATGCCCAGCGGTGACAGCCAGGAGCTT
GTCCACCGCGGCAGTTACGAAGCCACGCCGCAAAAGACGCCGACGTCGACACCAATGCGGCACGAGGTGCTGAGA
AACGAGGCCCATCGGTACTCGGCCCCTTCGCATCCAGGCCGGCCAATTTTCAAGCCCTACGTGCCTCCGTCATCA
GATCATCGCGATGCCTCACCCCTGGATTCGGCACCGCGATATCACTCATACGATGCTGCCGACGACGCGTACTAC
CGGCCGATGCAGGCCACCGTCGAGGACGCACCGGAGTCTCCCCCCGGAGTCCAGCATGCGTCGTACGGACACGTC
GTGGCTGCCATGTCGAGACCGCACGACGACGAAATGATGTTTGACGTGCCACCGCGCACCGAGTCGATGGACCTC
CGAACCTCCCCTGGGCCGTCGCACCACGCCAGTTACTCTAATGGCCGCTACTACCAGGAGGACAACCTTGCAGAA
CATGCTCAGAGCCCTCCGTACCATATTCGTTCTCCTCAGAGACACGAGCGCGTTCCACACGACGGATTTGGTTCG
AGGTACGATCTGCCAGACGTCCCTGCTTCGTTGTCGCCCGGCCTGGACCCGAACCTTTCACGAGAGATCTCGGAG
CAGATGCTCGAGGAGCGTCGCAGCATGGCTCGACACTCTCCACCGCCCCTGTCAACGCCCACCCGTGGACATCAC
AAGGAAAAGGCGGCGTCGGTCTCGTACTCGCCTTACGCGGCGGGATACACTGCCCGCCCCTACGAATGCCGGCCC
GAAGCTGCCGATAACCAGCTGGTTCGTCAAGGCGACGCGGGCCGTAACGCCAGATACAGTATTCCCCGGAAATCG
GTGAGCCCCGGCCCGCCGCTTGCGGAGAACAGGTTGCTGGCCGACACACCCTACAGCCCCGACTCGTACGACGCT
CTCAACCCTGGCTTGAGGGCTGGAGGTCCGGACAACGAGCGGGTCGAGGTTGAGGGCAAGATTATCTTGCACGAC
GGCCGTGAGGTTGATCCGTCGGATCACCTACCGATGGAGTCGTGGGCACCGGAGCCGGAACCCAAATACCAGACA
CCGACGAAACCCCCACCAGAGCAGCGGACACGGCCCTCCCCATCTGGGGCGCAGCCCATGCCGCCCAGTGGCCGG
AGGCCGCTCCGGATCGCTGCGGCTCAGCCCAACATGGTGACACCGCCGCCGCCACACAAGCTCCCCGACAGCCCC
TATACGGCTTCACCGCGGGGTGGCGGCGGTGGACGCGGTCGTCTTCAGAAGAAGACGGATCGAGGCAGCCCGTGG
GCGCACTCTTGGACGGGATCGAGTCCTCTCGCTCCCGTGTCGACGGACAAGCTGCAGGGCAGACAGGGGCGATTC
ACTCCGGGCAGTGATGGTGTGCCCCGCTGGGGCTCATGGGATTGCAGCATCGAGAACCACCCTCAGCAGGACATG
TCTCCGCAAGCGCACGGGAAGATGGGGTTTCCGATGATGAATGAAGGCGGGCACGTGGACGTGGCGCTGATGAGG
GAGATGCAGGGCATTGACATTGGGTCAGCCGCCTCTCAAGATGGCGACAGCGGCCCTGCCAAGGCCATGACGTCC
CCGGGCTCGATCCCGCAGACGCTATGGGACTCGCGGATCCCGCTTCTGATCCAGCACGCGACGCGGCCCTCGGCG
ACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTACCTGGCGCTCCTGCTGCCGCGGCTGACGGCCTTTTTCGGC
GCGCCCTGCTCGAGCTTTCACTTTGAGGAGGTGCAGCTGAGGAATCTGGCGGCTGGGCTGCTGGTGGATTTGTAT
AGGCCGAGTTGGCCGTGGCGGCTGACGGTTGGGGATGGGGTGGGATGGGATATTGCCGATACTTTTCTTAACTGT
GTTAAGGAGGCCGACTTTATTCGCAACGGCAACGCAAACCAGATCATGAAGATGTCCAAGGACCACACGACGCAG
CTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGCTCCAAGTCCAAACTCGCCTCCTCAACGCACCGACA
ACACTCAAGCACGTCCCCCTGAGAGTCTACATCCCCTCGCCTCCGCCAGGACCGGAGCCCAACCTCGAACCGGAC
ACGGGCTCTTTCAAGGTCATACAGTCGCTCATCGCGGCCGTCGGTCCGGATCGAAGACCGACGCTTTTGGGCCAG
GCGCTCAAGGCTACGATGCCCAAGCTGTTCCCCAGCAGTCGAGACCCTGTTCTTGCCAGCGTTGTTCTGCATGGT
GCGCCGGCTCCGTTTGACGCGCCGCTGGCGGAGCTGATGAGGGAGGCTGCGTATCCCGATGGCTGGCTTTGCTTG
GTCGTCGTTGTCTAG
Transcript >Ophun1|1409
ATGGCGACGATGGCGGCTCCCAAGCCCAAGTCGTACGCCCTCAACGGCGGACATACTGCGGGCATCTTCGCTGAC
ATGTCCGTCGACGGGCCGCAGATTGGCACTCTCGTCATGGTCGTCGATCGGGCCAAGAACCTGCCCAACAGAAAG
ACCATTGGCAAGCAGGATCCTTATTGTGCTGCCAGGCTGGGAAAGGAGGCCAAGAAGACGGCTACAGATATTCGC
GGTGGCCAGACGCCCAAATGGGATCAAGAGCTGCGCTTCACTGTCCACGACTCGCCCGACTACTACCAGCTCAAA
ATGTCCGTCTTCACCGACGACAAGAAGACGGAACTGATTGGCGATGCCTGGATCGACCTCAAGGGCATCGTCGTT
CCTGGCGGCGGCCAGAGCGACATGTGGCAGAGCCTCGCGTGCAAGAACAAATATGCCGGCGAGATTCGCGTCGAG
ATCACCTACTACGACAGCCGGCCCAAGCCCGACAAGCCAGCTGCCTCCAAGCGCAGACAGCACCACGCTCAAGCG
CAGCCCCAGCAGTCGCCGCCCATGGTGCCTGACCAGGACACAATGTTGCGGACGCCAGTCAAGAGACGACCTCTG
CCATCGGATCCCGTCACAGGCGAGGCTCCGTCTCCTCAGTCGATTGGCAACGCCTCACCGGAGCCCCTTCACCAG
ACGTCCCCTCGACCTCACGTCTTTGTTCCGACGCAGTCGCCTCTGCAGGCAGTCGAGTATAATACACCTGCTCGA
CAGCTATCGGACCCGTACTCGCCATCTCAACCCGCCGGTCGTGTGGACGGCCCTCGCCCGGTGCATCGGGCTAGG
AACATGTCGGACTCCTCGTCACCACGTCTGTATGACGATAGGGGTCACGTTCAGAAAGGGCCCGTCTCGCCGTAC
GACCGTGGCCACCACTCTCCACTGCCGGACCACTACCACGAGATGCCAGCGCGGGAGGAGCCCAGGATGGACGAC
CAGATGCCAGAAAACGCATGTCCGCCGCCTCCTCCGGCTCATCGTTCCATGCCCAGCGGTGACAGCCAGGAGCTT
GTCCACCGCGGCAGTTACGAAGCCACGCCGCAAAAGACGCCGACGTCGACACCAATGCGGCACGAGGTGCTGAGA
AACGAGGCCCATCGGTACTCGGCCCCTTCGCATCCAGGCCGGCCAATTTTCAAGCCCTACGTGCCTCCGTCATCA
GATCATCGCGATGCCTCACCCCTGGATTCGGCACCGCGATATCACTCATACGATGCTGCCGACGACGCGTACTAC
CGGCCGATGCAGGCCACCGTCGAGGACGCACCGGAGTCTCCCCCCGGAGTCCAGCATGCGTCGTACGGACACGTC
GTGGCTGCCATGTCGAGACCGCACGACGACGAAATGATGTTTGACGTGCCACCGCGCACCGAGTCGATGGACCTC
CGAACCTCCCCTGGGCCGTCGCACCACGCCAGTTACTCTAATGGCCGCTACTACCAGGAGGACAACCTTGCAGAA
CATGCTCAGAGCCCTCCGTACCATATTCGTTCTCCTCAGAGACACGAGCGCGTTCCACACGACGGATTTGGTTCG
AGGTACGATCTGCCAGACGTCCCTGCTTCGTTGTCGCCCGGCCTGGACCCGAACCTTTCACGAGAGATCTCGGAG
CAGATGCTCGAGGAGCGTCGCAGCATGGCTCGACACTCTCCACCGCCCCTGTCAACGCCCACCCGTGGACATCAC
AAGGAAAAGGCGGCGTCGGTCTCGTACTCGCCTTACGCGGCGGGATACACTGCCCGCCCCTACGAATGCCGGCCC
GAAGCTGCCGATAACCAGCTGGTTCGTCAAGGCGACGCGGGCCGTAACGCCAGATACAGTATTCCCCGGAAATCG
GTGAGCCCCGGCCCGCCGCTTGCGGAGAACAGGTTGCTGGCCGACACACCCTACAGCCCCGACTCGTACGACGCT
CTCAACCCTGGCTTGAGGGCTGGAGGTCCGGACAACGAGCGGGTCGAGGTTGAGGGCAAGATTATCTTGCACGAC
GGCCGTGAGGTTGATCCGTCGGATCACCTACCGATGGAGTCGTGGGCACCGGAGCCGGAACCCAAATACCAGACA
CCGACGAAACCCCCACCAGAGCAGCGGACACGGCCCTCCCCATCTGGGGCGCAGCCCATGCCGCCCAGTGGCCGG
AGGCCGCTCCGGATCGCTGCGGCTCAGCCCAACATGGTGACACCGCCGCCGCCACACAAGCTCCCCGACAGCCCC
TATACGGCTTCACCGCGGGGTGGCGGCGGTGGACGCGGTCGTCTTCAGAAGAAGACGGATCGAGGCAGCCCGTGG
GCGCACTCTTGGACGGGATCGAGTCCTCTCGCTCCCGTGTCGACGGACAAGCTGCAGGGCAGACAGGGGCGATTC
ACTCCGGGCAGTGATGGTGTGCCCCGCTGGGGCTCATGGGATTGCAGCATCGAGAACCACCCTCAGCAGGACATG
TCTCCGCAAGCGCACGGGAAGATGGGGTTTCCGATGATGAATGAAGGCGGGCACGTGGACGTGGCGCTGATGAGG
GAGATGCAGGGCATTGACATTGGGTCAGCCGCCTCTCAAGATGGCGACAGCGGCCCTGCCAAGGCCATGACGTCC
CCGGGCTCGATCCCGCAGACGCTATGGGACTCGCGGATCCCGCTTCTGATCCAGCACGCGACGCGGCCCTCGGCG
ACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTACCTGGCGCTCCTGCTGCCGCGGCTGACGGCCTTTTTCGGC
GCGCCCTGCTCGAGCTTTCACTTTGAGGAGGTGCAGCTGAGGAATCTGGCGGCTGGGCTGCTGGTGGATTTGTAT
AGGCCGAGTTGGCCGTGGCGGCTGACGGTTGGGGATGGGGTGGGATGGGATATTGCCGATACTTTTCTTAACTGT
GTTAAGGAGGCCGACTTTATTCGCAACGGCAACGCAAACCAGATCATGAAGATGTCCAAGGACCACACGACGCAG
CTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGCTCCAAGTCCAAACTCGCCTCCTCAACGCACCGACA
ACACTCAAGCACGTCCCCCTGAGAGTCTACATCCCCTCGCCTCCGCCAGGACCGGAGCCCAACCTCGAACCGGAC
ACGGGCTCTTTCAAGGTCATACAGTCGCTCATCGCGGCCGTCGGTCCGGATCGAAGACCGACGCTTTTGGGCCAG
GCGCTCAAGGCTACGATGCCCAAGCTGTTCCCCAGCAGTCGAGACCCTGTTCTTGCCAGCGTTGTTCTGCATGGT
GCGCCGGCTCCGTTTGACGCGCCGCTGGCGGAGCTGATGAGGGAGGCTGCGTATCCCGATGGCTGGCTTTGCTTG
GTCGTCGTTGTCTAG
Gene >Ophun1|1409
ATGGCGACGATGGCGGCTCCCAAGCCCAAGTCGTACGCCCTCAACGGCGGACATACTGCGGGCATCTTCGCTGAC
ATGTCCGTCGACGGGCCGCAGATTGGCACTCTCGTCATGGTCGTCGATCGGGCCAAGAACCTGCCCAACAGAAAG
ACCATTGGCAAGCAGGATCCTTATTGTGCTGCCAGGCTGGGAAAGGAGGCCAAGAAGACGGCTACAGATATTCGC
GGTGGCCAGACGCCCAAATGGTACGTTCGACGCTTTTCACCTCGCTACAGCCCAAGTATCTGACCTCGCTTCATA
GGGATCAAGAGCTGCGCTTCACTGTCCACGACTCGCCCGACTACTACCAGCTCAAAATGTCCGTCTTCACCGACG
ACAAGAAGACGGAACTGATTGGCGATGCCTGGATCGACCTCAAGGGCATCGTCGTTCCTGGCGGCGGCCAGAGCG
ACATGTGGCAGAGCCTCGCGTGCAAGAACAAATATGCCGGCGAGATTCGCGTCGAGATCACCTACTACGACAGCC
GGCCCAAGCCCGACAAGCCAGCTGCCTCCAAGCGCAGACAGCACCACGCTCAAGCGCAGCCCCAGCAGTCGCCGC
CCATGGTGCCTGACCAGGACACAATGTTGCGGACGCCAGTCAAGAGACGACCTCTGCCATCGGATCCCGTCACAG
GCGAGGCTCCGTCTCCTCAGTCGATTGGCAACGCCTCACCGGAGCCCCTTCACCAGACGTCCCCTCGACCTCACG
TCTTTGTTCCGACGCAGTCGCCTCTGCAGGCAGTCGAGTATAATACACCTGCTCGACAGCTATCGGACCCGTACT
CGCCATCTCAACCCGCCGGTCGTGTGGACGGCCCTCGCCCGGTGCATCGGGCTAGGAACATGTCGGACTCCTCGT
CACCACGTCTGTATGACGATAGGGGTCACGTTCAGAAAGGGCCCGTCTCGCCGTACGACCGTGGCCACCACTCTC
CACTGCCGGACCACTACCACGAGATGCCAGCGCGGGAGGAGCCCAGGATGGACGACCAGATGCCAGAAAACGCAT
GTCCGCCGCCTCCTCCGGCTCATCGTTCCATGCCCAGCGGTGACAGCCAGGAGCTTGTCCACCGCGGCAGTTACG
AAGCCACGCCGCAAAAGACGCCGACGTCGACACCAATGCGGCACGAGGTGCTGAGAAACGAGGCCCATCGGTACT
CGGCCCCTTCGCATCCAGGCCGGCCAATTTTCAAGCCCTACGTGCCTCCGTCATCAGATCATCGCGATGCCTCAC
CCCTGGATTCGGCACCGCGATATCACTCATACGATGCTGCCGACGACGCGTACTACCGGCCGATGCAGGCCACCG
TCGAGGACGCACCGGAGTCTCCCCCCGGAGTCCAGCATGCGTCGTACGGACACGTCGTGGCTGCCATGTCGAGAC
CGCACGACGACGAAATGATGTTTGACGTGCCACCGCGCACCGAGTCGATGGACCTCCGAACCTCCCCTGGGCCGT
CGCACCACGCCAGTTACTCTAATGGCCGCTACTACCAGGAGGACAACCTTGCAGAACATGCTCAGAGCCCTCCGT
ACCATATTCGTTCTCCTCAGAGACACGAGCGCGTTCCACACGACGGATTTGGTTCGAGGTACGATCTGCCAGACG
TCCCTGCTTCGTTGTCGCCCGGCCTGGACCCGAACCTTTCACGAGAGATCTCGGAGCAGATGCTCGAGGAGCGTC
GCAGCATGGCTCGACACTCTCCACCGCCCCTGTCAACGCCCACCCGTGGACATCACAAGGAAAAGGCGGCGTCGG
TCTCGTACTCGCCTTACGCGGCGGGATACACTGCCCGCCCCTACGAATGCCGGCCCGAAGCTGCCGATAACCAGC
TGGTTCGTCAAGGCGACGCGGGCCGTAACGCCAGATACAGTATTCCCCGGAAATCGGTGAGCCCCGGCCCGCCGC
TTGCGGAGAACAGGTTGCTGGCCGACACACCCTACAGCCCCGACTCGTACGACGCTCTCAACCCTGGCTTGAGGG
CTGGAGGTCCGGACAACGAGCGGGTCGAGGTTGAGGGCAAGATTATCTTGCACGACGGCCGTGAGGTTGATCCGT
CGGATCACCTACCGATGGAGTCGTGGGCACCGGAGCCGGAACCCAAATACCAGACACCGACGAAACCCCCACCAG
AGCAGCGGACACGGCCCTCCCCATCTGGGGCGCAGCCCATGCCGCCCAGTGGCCGGAGGCCGCTCCGGATCGCTG
CGGCTCAGCCCAACATGGTGACACCGCCGCCGCCACACAAGCTCCCCGACAGCCCCTATACGGCTTCACCGCGGG
GTGGCGGCGGTGGACGCGGTCGTCTTCAGAAGAAGACGGATCGAGGCAGCCCGTGGGCGCACTCTTGGACGGGAT
CGAGTCCTCTCGCTCCCGTGTCGACGGACAAGCTGCAGGGCAGACAGGGGCGATTCACTCCGGGCAGTGATGGTG
TGCCCCGCTGGGGCTCATGGGATTGCAGCATCGAGAACCACCCTCAGCAGGACATGTCTCCGCAAGCGCACGGGA
AGATGGGGTTTCCGATGATGAATGAAGGCGGGCACGTGGACGTGGCGCTGATGAGGGAGATGCAGGGCATTGACA
TTGGGTCAGGTAGGTCGAGGCGCAGAGGCGGAGGCTATTGATTTATGATGTAGATGAGTTGCATCTCGGTTCGAG
ATACCCGGACGATGGGATTTGGTTTGCGGTCGACGAGGGATGGATGACTGGGTTGTCCGGGAGGCGTGTACGAGT
CAAGACGAAAGGGAAAAAAAGGGAAAAATGGCGGTTAAAACTGTGGGACAAAGGATGGGACGACGAGGGCTTTGG
GTTTGAATAAGAAAAGACGAGTGTATGACTACTGTGAAATTACACGCTCGAGTGGTTTGAACAAAACACTTGTGA
AGGCCGCAGTTGGAAGATGGTGTCTCGTCTTTGCCTGGTGAATGGTGCGTTTGTGGTGCTCTTTTGCGGCCCAGT
TGAGTGTGTGAGAGAGGAATTTATAACATAAATCCAGAAAAGTATTTCATCTCTTCATTAATCCAGTCGCTATTC
CTCGTCTCGTCTCGAACCCTCAAGAAGATGCTGTCGACGAGAAGACGTTGACCGGGTGGGCCATCCATGACTAAC
ATCCCGCGATAAGAAGCGATAAGCAACTCCACCCAAGAAAACACCACAAGCATCGCGACAAGCTTCAGCCGCCTC
TCAAGATGGCGACAGCGGCCCTGCCAAGGCCATGACGTCCCCGGGCTCGATCCCGCAGACGCTATGGGACTCGCG
GATCCCGCTTCTGATCCAGCACGCGACGCGGCCCTCGGCGACGCCCTTTGTCACCAGCGTCCCGCGCTTCAGTTA
CCTGGCGCTCCTGCTGCCGCGGCTGACGGCCTTTTTCGGCGCGCCCTGCTCGAGCTTTCACTTTGAGGAGGTGCA
GCTGAGGAATCTGGCGGCTGGGCTGCTGGTGGATTTGTATAGGCCGAGTTGGCCGTGGCGGCTGACGGTTGGGGA
TGGGGTGGGATGGGATATTGCCGATACTTTTCTTAACTGTGTTAAGGAGGTGAGTTTCGCCTTCTTTGGGAGGGG
GACTATGGATGGAGAGAGGCTGAGACTGATAACCCGATATTCAGGCCGACTTTATTCGCAACGGCAACGCAAACC
AGATCATGAAGATGTCCAAGGACCACACGACGCAGCTCTGGAACGCAGTCATCGACAACGACTACGCCTCCTGGC
TCCAAGTCCAAACTCGCCTCCTCAACGCACCGACAACACTCAAGCACGTCCCCCTGAGAGTCTACATCCCCTCGC
CTCCGCCAGGACCGGAGCCCAACCTCGAACCGGACACGGGCTCTTTCAAGGTCATACAGTCGCTCATCGCGGCCG
TCGGTCCGGATCGAAGACCGACGCTTTTGGGCCAGGCGCTCAAGGCTACGATGCCCAAGCTGTTCCCCAGCAGTC
GAGACCCTGTTCTTGCCAGCGTTGTTCTGCATGGTGCGCCGGCTCCGTTTGACGCGCCGCTGGCGGAGCTGATGA
GGGAGGCTGCGTATCCCGATGGCTGGCTTTGCTTGGTCGTCGTTGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail