Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1406
Gene name
LocationContig_157:15298..16119
Strand-
Gene length (bp)821
Transcript length (bp)417
Coding sequence length (bp)417
Protein length (aa) 139

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02036 SCP2 SCP-2 sterol transfer family 2.2E-25 34 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P80547|SCP2_YARLI Fatty acid-binding protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SCP2 PE=1 SV=4 18 133 5.0E-33
sp|Q00680|POX18_CANMA Oleate-induced peroxisomal protein POX18 OS=Candida maltosa GN=POX18 PE=2 SV=2 18 138 4.0E-21
sp|P22009|POX18_CANTR Oleate-induced peroxisomal protein POX18 OS=Candida tropicalis GN=POX18 PE=1 SV=3 18 138 3.0E-20
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 18 133 1.0E-12
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 41 130 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P80547|SCP2_YARLI Fatty acid-binding protein OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SCP2 PE=1 SV=4 18 133 5.0E-33
sp|Q00680|POX18_CANMA Oleate-induced peroxisomal protein POX18 OS=Candida maltosa GN=POX18 PE=2 SV=2 18 138 4.0E-21
sp|P22009|POX18_CANTR Oleate-induced peroxisomal protein POX18 OS=Candida tropicalis GN=POX18 PE=1 SV=3 18 138 3.0E-20
sp|Q9NKW1|MFEA_DICDI Peroxisomal multifunctional enzyme A OS=Dictyostelium discoideum GN=mfeA PE=2 SV=1 18 133 1.0E-12
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 41 130 2.0E-11
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 41 130 6.0E-11
sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 6 135 6.0E-11
sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=1 SV=1 16 135 2.0E-10
sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 37 135 2.0E-10
sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 17 135 2.0E-10
sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 21 135 4.0E-10
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 42 130 4.0E-10
sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 20 129 5.0E-10
sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 17 135 8.0E-10
sp|Q23655|NLTP1_CAEEL Non-specific lipid-transfer protein-like 1 OS=Caenorhabditis elegans GN=nlt-1 PE=4 SV=1 27 138 8.0E-10
sp|Q07598|NLTP_CHICK Non-specific lipid-transfer protein (Fragment) OS=Gallus gallus GN=SCP2 PE=2 SV=1 18 138 7.0E-09
sp|P07857|NLTP_BOVIN Non-specific lipid-transfer protein OS=Bos taurus GN=SCP2 PE=1 SV=2 18 138 1.0E-08
sp|Q9DAH1|SCP2D_MOUSE SCP2 sterol-binding domain-containing protein 1 OS=Mus musculus GN=Scp2d1 PE=2 SV=2 10 131 3.0E-08
sp|P22307|NLTP_HUMAN Non-specific lipid-transfer protein OS=Homo sapiens GN=SCP2 PE=1 SV=2 44 138 8.0E-08
sp|P32020|NLTP_MOUSE Non-specific lipid-transfer protein OS=Mus musculus GN=Scp2 PE=1 SV=3 44 138 2.0E-07
sp|Q6P5L8|HSDL2_DANRE Hydroxysteroid dehydrogenase-like protein 2 OS=Danio rerio GN=hsdl2 PE=2 SV=1 21 138 2.0E-07
sp|Q9UBI4|STML1_HUMAN Stomatin-like protein 1 OS=Homo sapiens GN=STOML1 PE=1 SV=1 44 130 3.0E-07
sp|Q9UJQ7|SCP2D_HUMAN SCP2 sterol-binding domain-containing protein 1 OS=Homo sapiens GN=SCP2D1 PE=2 SV=1 44 130 3.0E-07
sp|Q2TBS3|SCP2D_BOVIN SCP2 sterol-binding domain-containing protein 1 OS=Bos taurus GN=SCP2D1 PE=2 SV=1 19 130 5.0E-07
sp|O62742|NLTP_RABIT Non-specific lipid-transfer protein OS=Oryctolagus cuniculus GN=SCP2 PE=1 SV=1 44 138 5.0E-07
sp|P11915|NLTP_RAT Non-specific lipid-transfer protein OS=Rattus norvegicus GN=Scp2 PE=1 SV=3 44 138 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3139
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5788
Ophiocordyceps australis map64 (Brazil) OphauB2|5002
Ophiocordyceps camponoti-floridani Ophcf2|02195
Ophiocordyceps camponoti-rufipedis Ophun1|1406 (this protein)
Ophiocordyceps kimflemingae Ophio5|2877
Ophiocordyceps subramaniannii Hirsu2|5515

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1406
MRIHVAIRWMTEAEPLRDKFPASAAFDVISQTLDSSDQDRKDAIKQANAVFAFTLKNKAGETESWHIDLKETGKV
GTGTGGKPTVTLSMSDDDFGKLVVGDANAQRLFMSGKLKIKGDIMKATKLDPIMKKAQGKAKL*
Coding >Ophun1|1406
ATGCGCATCCACGTGGCCATTCGATGGATGACGGAAGCGGAGCCACTCCGGGACAAGTTTCCCGCCTCGGCCGCC
TTCGACGTCATTAGCCAGACGCTCGACAGCAGCGATCAGGATCGCAAGGACGCCATCAAGCAGGCCAATGCCGTC
TTCGCCTTTACCCTGAAGAACAAGGCTGGCGAGACGGAGAGCTGGCACATTGACCTCAAGGAGACGGGCAAGGTC
GGGACCGGCACCGGCGGCAAGCCCACGGTCACCCTCTCAATGTCCGATGACGACTTCGGCAAGCTCGTCGTGGGC
GACGCCAATGCCCAGCGACTCTTCATGTCCGGCAAGCTCAAGATCAAGGGCGACATCATGAAGGCCACCAAGCTG
GATCCCATCATGAAGAAGGCGCAGGGCAAGGCCAAGCTGTGA
Transcript >Ophun1|1406
ATGCGCATCCACGTGGCCATTCGATGGATGACGGAAGCGGAGCCACTCCGGGACAAGTTTCCCGCCTCGGCCGCC
TTCGACGTCATTAGCCAGACGCTCGACAGCAGCGATCAGGATCGCAAGGACGCCATCAAGCAGGCCAATGCCGTC
TTCGCCTTTACCCTGAAGAACAAGGCTGGCGAGACGGAGAGCTGGCACATTGACCTCAAGGAGACGGGCAAGGTC
GGGACCGGCACCGGCGGCAAGCCCACGGTCACCCTCTCAATGTCCGATGACGACTTCGGCAAGCTCGTCGTGGGC
GACGCCAATGCCCAGCGACTCTTCATGTCCGGCAAGCTCAAGATCAAGGGCGACATCATGAAGGCCACCAAGCTG
GATCCCATCATGAAGAAGGCGCAGGGCAAGGCCAAGCTGTGA
Gene >Ophun1|1406
ATGCGCATCCACGTGGCCATTCGATGGATGACGGAAGCGGAGCCACTCCGGGGTACGCCGAGGGAACCTCCGGAG
CCGCCAGAACGAACCCCTGCAGCCACCGACGCCAGCGGTAACGCCCAGGTCGCAGACGGGTAACGCGCCGCTCTC
GCCCATGCCGAGGTTAAGGCCATCACTCACATGCCGCTTCCAGCTTAGTCGATGCTGGACAGGGTGCATGGGGAG
ATGGATATCTACTTAAAGCCAACATCATCCTCCGGCCGAAGCTTACCATCTTGCAAGCTGTTTGGACTGAAGCAG
TCATGTCTCTCAAGAACGGTAACGTCTCCCCGTCGTCACTTTGGTACGTAGGTATGTATGTACGTGTCCTCTGAC
GACAGCGCCCGCAGACAAGTTTCCCGCCTCGGCCGCCTTCGACGTCATTAGCCAGACGCTCGACAGCAGCGATCA
GGATCGCAAGGACGCCATCAAGCAGGCCAATGCCGTCTTCGCCTTTACCCTGAAGAACAAGGCTGGCGAGACGGA
GAGCTGGCACATTGACCTCAAGGAGACGGGCAAGGTCGGGACCGGCACCGGCGGCAAGCCCACGGGTATGTAAAC
TCCCCGCCTCATGCCTTTGTTCTTTGCGCGCCTGGCTGAAAGAGGTCCGTTCGCAAGTCACCCTCTCAATGTCCG
ATGACGACTTCGGCAAGCTCGTCGTGGGCGACGCCAATGCCCAGCGACTCTTCATGTCCGGCAAGCTCAAGATCA
AGGGCGACATCATGAAGGCCACCAAGCTGGATCCCATCATGAAGAAGGCGCAGGGCAAGGCCAAGCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail