Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1401
Gene name
LocationContig_157:2620..4389
Strand-
Gene length (bp)1769
Transcript length (bp)1719
Coding sequence length (bp)1719
Protein length (aa) 573

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 1.0E-06 515 549
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 8.0E-04 457 491
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 1.0E-07 514 549
PF00172 Zn_clus Fungal Zn(2)-Cys(6) binuclear cluster domain 1.4E-09 148 183
PF12464 Mac Maltose acetyltransferase 2.8E-08 366 418

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P37515|MAA_BACSU Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) GN=maa PE=3 SV=1 360 566 9.0E-43
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 360 564 9.0E-42
sp|P08632|NODL_RHILV Nodulation protein L OS=Rhizobium leguminosarum bv. viciae GN=nodL PE=3 SV=1 360 567 5.0E-38
sp|P77791|MAA_ECOLI Maltose O-acetyltransferase OS=Escherichia coli (strain K12) GN=maa PE=1 SV=3 361 566 7.0E-36
sp|Q4L967|ATRF2_STAHJ Putative acetyltransferase SH0499 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0499 PE=3 SV=1 361 568 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P37515|MAA_BACSU Probable maltose O-acetyltransferase OS=Bacillus subtilis (strain 168) GN=maa PE=3 SV=1 360 566 9.0E-43
sp|P28266|NODL_RHIME Nodulation protein L OS=Rhizobium meliloti (strain 1021) GN=nodL PE=3 SV=1 360 564 9.0E-42
sp|P08632|NODL_RHILV Nodulation protein L OS=Rhizobium leguminosarum bv. viciae GN=nodL PE=3 SV=1 360 567 5.0E-38
sp|P77791|MAA_ECOLI Maltose O-acetyltransferase OS=Escherichia coli (strain K12) GN=maa PE=1 SV=3 361 566 7.0E-36
sp|Q4L967|ATRF2_STAHJ Putative acetyltransferase SH0499 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=SH0499 PE=3 SV=1 361 568 2.0E-35
sp|Q6GDP3|ATRF2_STAAR Putative acetyltransferase SAR2635 OS=Staphylococcus aureus (strain MRSA252) GN=SAR2635 PE=3 SV=1 361 568 5.0E-34
sp|Q09707|YA39_SCHPO Putative acetyltransferase C18B11.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.09c PE=3 SV=2 359 568 6.0E-34
sp|Q7A3E8|ATRF2_STAAN Putative acetyltransferase SA2342 OS=Staphylococcus aureus (strain N315) GN=SA2342 PE=1 SV=1 361 568 3.0E-33
sp|Q7A2K9|ATRF2_STAAM Putative acetyltransferase SAV2555 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV2555 PE=3 SV=1 361 568 3.0E-33
sp|Q9KWJ8|ATRF2_STAA1 Putative acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=SAHV_2539 PE=3 SV=1 361 568 3.0E-33
sp|Q8NUR1|ATRF2_STAAW Putative acetyltransferase MW2476 OS=Staphylococcus aureus (strain MW2) GN=MW2476 PE=3 SV=1 361 568 7.0E-33
sp|Q6G6B9|ATRF2_STAAS Putative acetyltransferase SAS2441 OS=Staphylococcus aureus (strain MSSA476) GN=SAS2441 PE=3 SV=1 361 568 7.0E-33
sp|Q5HCZ5|ATRF2_STAAC Putative acetyltransferase SACOL2570 OS=Staphylococcus aureus (strain COL) GN=SACOL2570 PE=1 SV=1 361 568 7.0E-33
sp|Q552S7|Y5913_DICDI Putative acetyltransferase DDB_G0275913 OS=Dictyostelium discoideum GN=DDB_G0275913 PE=3 SV=1 359 570 1.0E-32
sp|P40892|YJV8_YEAST Putative acetyltransferase YJL218W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJL218W PE=1 SV=1 436 568 7.0E-30
sp|Q54UU2|Y0825_DICDI Putative acetyltransferase DDB_G0280825 OS=Dictyostelium discoideum GN=DDB_G0280825 PE=3 SV=1 361 568 8.0E-29
sp|Q86A05|Y5507_DICDI Putative acetyltransferase DDB_G0275507 OS=Dictyostelium discoideum GN=DDB_G0275507 PE=3 SV=1 361 566 5.0E-28
sp|P52984|THGA_LACLA Galactoside O-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lacA PE=3 SV=1 359 568 2.0E-24
sp|P07464|THGA_ECOLI Galactoside O-acetyltransferase OS=Escherichia coli (strain K12) GN=lacA PE=1 SV=1 409 568 2.0E-24
sp|A7GS09|DAPH_BACCN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dapH PE=3 SV=1 477 568 4.0E-15
sp|B7GIC1|DAPH_ANOFW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dapH PE=3 SV=1 476 568 1.0E-14
sp|B9K867|DAPH_THENN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=dapH PE=3 SV=1 457 568 2.0E-14
sp|A1ADJ6|NEUO_ECOK1 Polysialic acid O-acetyltransferase OS=Escherichia coli O1:K1 / APEC GN=neuO PE=1 SV=1 460 566 3.0E-14
sp|Q8ERA4|DAPH_OCEIH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dapH PE=3 SV=1 476 568 7.0E-13
sp|Q06750|CYSE_BACSU Serine acetyltransferase OS=Bacillus subtilis (strain 168) GN=cysE PE=1 SV=1 465 565 1.0E-12
sp|Q58464|Y1064_METJA Uncharacterized acetyltransferase MJ1064 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1064 PE=3 SV=1 457 566 1.0E-12
sp|Q39218|SAT3_ARATH Serine acetyltransferase 3, mitochondrial OS=Arabidopsis thaliana GN=SAT3 PE=1 SV=3 465 567 3.0E-12
sp|A8F961|CYSE_BACP2 Serine acetyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=cysE PE=3 SV=1 465 565 4.0E-12
sp|Q8W0E4|SAT1_ORYSJ Probable serine acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=SAT1 PE=2 SV=1 465 567 5.0E-12
sp|Q65PC9|CYSE_BACLD Serine acetyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cysE PE=3 SV=1 465 565 1.0E-11
sp|Q5FKR1|DAPH_LACAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dapH PE=3 SV=1 457 566 1.0E-11
sp|Q42588|SAT1_ARATH Serine acetyltransferase 1, chloroplastic OS=Arabidopsis thaliana GN=SAT1 PE=1 SV=2 465 567 2.0E-11
sp|Q8RBI7|DAPH_CALS4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=dapH PE=3 SV=1 457 566 2.0E-11
sp|A9BHR6|DAPH_PETMO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=dapH PE=3 SV=1 477 566 3.0E-11
sp|P32003|CYSE_BUCAP Serine acetyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=cysE PE=3 SV=1 465 568 4.0E-11
sp|Q2YXZ7|DAPH_STAAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dapH PE=3 SV=1 514 566 5.0E-11
sp|B0K4I5|DAPH_THEPX 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter sp. (strain X514) GN=dapH PE=3 SV=1 457 566 7.0E-11
sp|B0KAL9|DAPH_THEP3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=dapH PE=3 SV=1 457 566 8.0E-11
sp|Q7A0X6|DAPH_STAAW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MW2) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q9EZ10|DAPH_STAAU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|A8Z3X5|DAPH_STAAT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q6G9G4|DAPH_STAAS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q7A5P7|DAPH_STAAN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain N315) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q7A2S0|DAPH_STAAM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapH PE=1 SV=1 514 566 2.0E-10
sp|Q5HG23|DAPH_STAAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain COL) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|A5ISS9|DAPH_STAA9 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH9) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q2FYN7|DAPH_STAA8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q2FH41|DAPH_STAA3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain USA300) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|A6U1L8|DAPH_STAA2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain JH1) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|A7X274|DAPH_STAA1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dapH PE=3 SV=1 514 566 2.0E-10
sp|Q6GH11|DAPH_STAAR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=dapH PE=3 SV=1 514 566 3.0E-10
sp|C4L2D4|DAPH_EXISA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dapH PE=3 SV=1 462 566 3.0E-10
sp|P0ACD3|WCAF_SHIFL Putative colanic acid biosynthesis acetyltransferase WcaF OS=Shigella flexneri GN=wcaF PE=3 SV=1 437 566 3.0E-10
sp|P0ACD2|WCAF_ECOLI Putative colanic acid biosynthesis acetyltransferase WcaF OS=Escherichia coli (strain K12) GN=wcaF PE=3 SV=1 437 566 3.0E-10
sp|P23364|CAT4_AGRFC Chloramphenicol acetyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cat PE=3 SV=1 463 566 3.0E-10
sp|B1IMX1|DAPH_CLOBK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=dapH PE=3 SV=1 514 570 3.0E-10
sp|A5I6N5|DAPH_CLOBH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=dapH PE=3 SV=1 514 570 3.0E-10
sp|A7FYA5|DAPH_CLOB1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=dapH PE=3 SV=1 514 570 3.0E-10
sp|C1FL32|DAPH_CLOBJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=dapH PE=3 SV=1 514 570 4.0E-10
sp|C3KTL7|DAPH_CLOB6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=dapH PE=3 SV=1 514 570 4.0E-10
sp|A7GI22|DAPH_CLOBL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=dapH PE=3 SV=1 514 570 4.0E-10
sp|P26838|CAT4_ECOLX Chloramphenicol acetyltransferase OS=Escherichia coli GN=catB2 PE=3 SV=2 472 566 4.0E-10
sp|B1L0V4|DAPH_CLOBM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=dapH PE=3 SV=1 514 570 4.0E-10
sp|Q0DGG8|SAT5_ORYSJ Probable serine acetyltransferase 5 OS=Oryza sativa subsp. japonica GN=SAT5 PE=2 SV=2 464 565 5.0E-10
sp|B9DP25|DAPH_STACT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus carnosus (strain TM300) GN=dapH PE=3 SV=1 441 566 5.0E-10
sp|Q03CW1|DAPH_LACC3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain ATCC 334) GN=dapH PE=3 SV=1 476 566 5.0E-10
sp|P50868|CAT4_ENTAE Chloramphenicol acetyltransferase OS=Enterobacter aerogenes GN=catB4 PE=3 SV=1 472 566 6.0E-10
sp|Q42538|SAT5_ARATH Serine acetyltransferase 5 OS=Arabidopsis thaliana GN=SAT5 PE=1 SV=1 465 567 8.0E-10
sp|Q7A1G0|ATRF1_STAAW Putative acetyltransferase MW0724 OS=Staphylococcus aureus (strain MW2) GN=MW0724 PE=3 SV=1 456 561 9.0E-10
sp|Q6GB68|ATRF1_STAAS Putative acetyltransferase SAS0727 OS=Staphylococcus aureus (strain MSSA476) GN=SAS0727 PE=3 SV=1 456 561 9.0E-10
sp|Q6GIM9|ATRF1_STAAR Putative acetyltransferase SAR0816 OS=Staphylococcus aureus (strain MRSA252) GN=SAR0816 PE=3 SV=1 456 561 9.0E-10
sp|Q7A6Q9|ATRF1_STAAN Putative acetyltransferase SA0717 OS=Staphylococcus aureus (strain N315) GN=SA0717 PE=3 SV=1 456 561 9.0E-10
sp|Q99VL4|ATRF1_STAAM Putative acetyltransferase SAV0762 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=SAV0762 PE=3 SV=1 456 561 9.0E-10
sp|Q5HHQ6|ATRF1_STAAC Putative acetyltransferase SACOL0827 OS=Staphylococcus aureus (strain COL) GN=SACOL0827 PE=3 SV=1 456 561 9.0E-10
sp|A6QGU8|DAPH_STAAE 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus aureus (strain Newman) GN=dapH PE=3 SV=1 514 566 1.0E-09
sp|B3W7E7|DAPH_LACCB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus casei (strain BL23) GN=dapH PE=3 SV=1 476 566 2.0E-09
sp|Q8S895|SAT2_ARATH Serine acetyltransferase 2 OS=Arabidopsis thaliana GN=SAT2 PE=1 SV=2 465 566 2.0E-09
sp|B1YJ41|DAPH_EXIS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dapH PE=3 SV=1 477 566 2.0E-09
sp|Q03YE4|DAPH_LEUMM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dapH PE=3 SV=1 476 568 3.0E-09
sp|P50869|CAT4_MORMO Chloramphenicol acetyltransferase OS=Morganella morganii GN=cat PE=3 SV=1 472 566 3.0E-09
sp|O74308|YOG2_SCHPO Uncharacterized transcriptional regulatory protein C15D4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15D4.02 PE=3 SV=3 118 180 3.0E-09
sp|Q6LAN4|DAPH_LISIV 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria ivanovii GN=dapH PE=3 SV=1 476 566 4.0E-09
sp|C1CU00|DAPH_STRZT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dapH PE=3 SV=1 476 568 5.0E-09
sp|C5CHX7|DAPH_KOSOT 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=dapH PE=3 SV=1 453 566 6.0E-09
sp|P26841|CAT4_PSEAE Chloramphenicol acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cat PE=1 SV=3 472 566 6.0E-09
sp|A6LP60|DAPH_THEM4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=dapH PE=3 SV=1 453 566 8.0E-09
sp|Q10S58|SAT2_ORYSJ Probable serine acetyltransferase 2 OS=Oryza sativa subsp. japonica GN=SAT2 PE=2 SV=1 465 565 9.0E-09
sp|Q4L6A2|DAPH_STAHJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dapH PE=3 SV=1 514 566 9.0E-09
sp|Q88V23|DAPH_LACPL 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dapH PE=3 SV=1 457 568 1.0E-08
sp|A3CQT5|DAPH_STRSV 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus sanguinis (strain SK36) GN=dapH PE=3 SV=1 476 568 1.0E-08
sp|P39856|CAPG_STAAU Protein CapG OS=Staphylococcus aureus GN=capG PE=3 SV=1 515 568 1.0E-08
sp|C1CH25|DAPH_STRZJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|Q8DN54|DAPH_STRR6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|B2IN15|DAPH_STRPS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|B8ZPL9|DAPH_STRPJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|B1I9G3|DAPH_STRPI 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|C1CAS4|DAPH_STRP7 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|B5E3A4|DAPH_STRP4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|Q04I77|DAPH_STRP2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|C1CN43|DAPH_STRZP 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|Q97NE6|DAPH_STRPN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|P29847|CYSE_SALTY Serine acetyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysE PE=1 SV=1 465 565 2.0E-08
sp|A4ILT5|DAPH_GEOTN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dapH PE=3 SV=1 442 568 2.0E-08
sp|A8AUL9|DAPH_STRGC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=dapH PE=3 SV=1 476 568 2.0E-08
sp|A6LUD2|DAPH_CLOB8 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dapH PE=3 SV=1 457 568 3.0E-08
sp|B7IF15|DAPH_THEAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermosipho africanus (strain TCF52B) GN=dapH PE=3 SV=1 479 566 3.0E-08
sp|O53281|Y3034_MYCTU Putative acetyltransferase Rv3034c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv3034c PE=1 SV=1 456 566 3.0E-08
sp|Q9UT46|MOC3_SCHPO Transcriptional regulatory protein moc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=moc3 PE=1 SV=4 145 181 3.0E-08
sp|P0A9D7|CYSE_SHIFL Serine acetyltransferase OS=Shigella flexneri GN=cysE PE=3 SV=1 465 565 4.0E-08
sp|P0A9D4|CYSE_ECOLI Serine acetyltransferase OS=Escherichia coli (strain K12) GN=cysE PE=1 SV=1 465 565 4.0E-08
sp|P0A9D5|CYSE_ECOL6 Serine acetyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysE PE=3 SV=1 465 565 4.0E-08
sp|P0A9D6|CYSE_ECO57 Serine acetyltransferase OS=Escherichia coli O157:H7 GN=cysE PE=3 SV=1 465 565 4.0E-08
sp|O34993|YVOF_BACSU Putative acetyltransferase YvoF OS=Bacillus subtilis (strain 168) GN=yvoF PE=3 SV=1 476 565 5.0E-08
sp|Q8DVY7|DAPH_STRMU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dapH PE=3 SV=1 514 568 7.0E-08
sp|A8YUT1|DAPH_LACH4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus helveticus (strain DPC 4571) GN=dapH PE=3 SV=1 457 566 7.0E-08
sp|B2G6M7|DAPH_LACRJ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=dapH PE=3 SV=1 476 568 7.0E-08
sp|A5VJ56|DAPH_LACRD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=dapH PE=3 SV=1 476 568 7.0E-08
sp|Q03IN0|DAPH_STRTD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=dapH PE=3 SV=1 442 568 8.0E-08
sp|Q5M2I4|DAPH_STRT2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dapH PE=3 SV=1 442 568 8.0E-08
sp|Q5LXY2|DAPH_STRT1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dapH PE=3 SV=1 442 568 8.0E-08
sp|C5D826|DAPH_GEOSW 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Geobacillus sp. (strain WCH70) GN=dapH PE=3 SV=1 476 568 9.0E-08
sp|Q6T1W7|FDTC_ANETH dTDP-3-amino-3,6-dideoxy-alpha-D-galactopyranose 3-N-acetyltransferase OS=Aneurinibacillus thermoaerophilus GN=fdtC PE=1 SV=1 450 564 1.0E-07
sp|B9DVY7|DAPH_STRU0 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dapH PE=3 SV=1 462 568 1.0E-07
sp|P50870|VATD_ENTFC Streptogramin A acetyltransferase OS=Enterococcus faecium GN=vatD PE=1 SV=1 470 566 2.0E-07
sp|B1MZN0|DAPH_LEUCK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Leuconostoc citreum (strain KM20) GN=dapH PE=3 SV=1 476 568 2.0E-07
sp|Q8W2B8|SAT4_ARATH Serine acetyltransferase 4 OS=Arabidopsis thaliana GN=SAT4 PE=1 SV=1 465 565 2.0E-07
sp|B2V5B7|DAPH_CLOBA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dapH PE=3 SV=1 457 568 2.0E-07
sp|A2RI05|DAPH_LACLM 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dapH PE=3 SV=1 476 568 3.0E-07
sp|B2TS78|DAPH_CLOBB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dapH PE=3 SV=1 457 566 3.0E-07
sp|P26839|VATA_STAAU Virginiamycin A acetyltransferase OS=Staphylococcus aureus GN=vat PE=1 SV=2 461 566 3.0E-07
sp|Q97GI6|DAPH_CLOAB 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dapH PE=3 SV=1 457 566 3.0E-07
sp|Q9CIS5|DAPH_LACLA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dapH PE=3 SV=1 513 568 3.0E-07
sp|Q10QH1|SAT4_ORYSJ Probable serine acetyltransferase 4 OS=Oryza sativa subsp. japonica GN=SAT4 PE=2 SV=1 465 572 3.0E-07
sp|Q8Y8A1|DAPH_LISMO 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|Q721F5|DAPH_LISMF 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|C1L1T2|DAPH_LISMC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|A0AHD1|DAPH_LISW6 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|B8DEC4|DAPH_LISMH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|Q92D11|DAPH_LISIN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dapH PE=3 SV=1 476 566 3.0E-07
sp|B7HMV2|DAPH_BACC7 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain AH187) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|Q819J5|DAPH_BACCR 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|B7H6W8|DAPH_BACC4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain B4264) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|B7IVL8|DAPH_BACC2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain G9842) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|A9VUE3|DAPH_BACWK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|Q6HEI4|DAPH_BACHK 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|Q635U7|DAPH_BACCZ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|B9IW61|DAPH_BACCQ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain Q1) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|C1EPZ5|DAPH_BACC3 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain 03BB102) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|Q731Y5|DAPH_BACC1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|B7JKV5|DAPH_BACC0 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus cereus (strain AH820) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|Q81MQ2|DAPH_BACAN 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus anthracis GN=dapH PE=1 SV=1 477 568 4.0E-07
sp|C3LI47|DAPH_BACAC 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|C3P6Y8|DAPH_BACAA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus anthracis (strain A0248) GN=dapH PE=3 SV=1 477 568 4.0E-07
sp|A6TT15|DAPH_ALKMQ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Alkaliphilus metalliredigens (strain QYMF) GN=dapH PE=3 SV=1 476 568 4.0E-07
sp|A4VY24|DAPH_STRSY 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=dapH PE=3 SV=2 476 568 4.0E-07
sp|A4W4B5|DAPH_STRS2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Streptococcus suis (strain 98HAH33) GN=dapH PE=3 SV=1 476 568 4.0E-07
sp|A0RHZ3|DAPH_BACAH 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=dapH PE=3 SV=1 477 568 5.0E-07
sp|Q032G9|DAPH_LACLS 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dapH PE=3 SV=1 476 568 7.0E-07
sp|O34981|DAPH_BACSU 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus subtilis (strain 168) GN=dapH PE=1 SV=2 476 568 8.0E-07
sp|Q9X1K7|DAPH_THEMA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dapH PE=3 SV=1 457 568 8.0E-07
sp|Q65K85|DAPH_BACLD 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dapH PE=3 SV=1 476 568 9.0E-07
sp|P26840|MATA_LYSSH Probable macrolide acetyltransferase (Fragment) OS=Lysinibacillus sphaericus PE=3 SV=1 517 566 1.0E-06
sp|B1LBQ9|DAPH_THESQ 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga sp. (strain RQ2) GN=dapH PE=3 SV=1 457 568 1.0E-06
sp|A5IM64|DAPH_THEP1 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dapH PE=3 SV=1 457 568 1.0E-06
sp|A7Z432|DAPH_BACMF 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dapH PE=3 SV=1 476 568 2.0E-06
sp|Q5ANB1|WOR2_CANAL White-opaque regulator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WOR2 PE=1 SV=1 149 180 2.0E-06
sp|A8FCN1|DAPH_BACP2 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=dapH PE=3 SV=1 476 568 3.0E-06
sp|P39720|OAF1_YEAST Oleate-activated transcription factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=OAF1 PE=1 SV=3 123 207 4.0E-06
sp|P37750|WBBJ_ECOLI Putative lipopolysaccharide biosynthesis O-acetyl transferase WbbJ OS=Escherichia coli (strain K12) GN=wbbJ PE=3 SV=2 515 566 6.0E-06
sp|Q5A0W9|CZF1_CANAL Zinc cluster transcription factor CZF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CZF1 PE=1 SV=1 80 204 7.0E-06
sp|P77985|CYSE_STAXY Serine acetyltransferase OS=Staphylococcus xylosus GN=cysE PE=3 SV=1 465 566 8.0E-06
sp|P28875|CZF1_CANAW Zinc finger protein 1 OS=Candida albicans (strain WO-1) GN=CZF1 PE=3 SV=2 80 204 8.0E-06
sp|Q5L146|DAPH_GEOKA 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=dapH PE=3 SV=1 442 568 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0008270 zinc ion binding Yes
GO:0016407 acetyltransferase activity Yes
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific Yes
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups No
GO:0019222 regulation of metabolic process No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No
GO:2001141 regulation of RNA biosynthetic process No
GO:0010468 regulation of gene expression No
GO:0046872 metal ion binding No
GO:0031323 regulation of cellular metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0009889 regulation of biosynthetic process No
GO:0140110 transcription regulator activity No
GO:0003824 catalytic activity No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0046914 transition metal ion binding No
GO:0051252 regulation of RNA metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0043167 ion binding No
GO:0003700 DNA-binding transcription factor activity No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0050794 regulation of cellular process No
GO:0043169 cation binding No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0065007 biological regulation No
GO:0080090 regulation of primary metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0050789 regulation of biological process No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
Fungal Specific TF

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3482
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1484
Ophiocordyceps australis map64 (Brazil) OphauB2|4995
Ophiocordyceps camponoti-floridani Ophcf2|02190
Ophiocordyceps camponoti-rufipedis Ophun1|1401 (this protein)
Ophiocordyceps kimflemingae Ophio5|2872
Ophiocordyceps subramaniannii Hirsu2|6647

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1401
MSTFTALNGSSPKTTDQDAPTPKPRTSPDDTWRPLSSHKRKRSGSPDPKPATPPRGFRPASEDAEYRDDRAAYDA
RRRSPSPNQDGQPADPLRPQLDQHSDYSHTSPDAEDRSAPLYGSPYAAEHGQDSAPQHDAKKRKRNFSNRTKTGC
LTCRKRKKKCDEHKPECSNCVRGGFVCAGYPPQRGPGWQKPDSKTAAVPLESKDPTYVPPGAYGMPQPSAYGPTQ
SVKREPLPHYRGQALRIDPPQGRPLAASDDDRPTASSLASASATSPETKLSAVAFAPSSSVFPTPVSANTAFGER
MAKEYPRVPPLHDAGREPDTPHALPQINILHPTRASSPTPSSAQVAAQLALSHPQYPQRRTQKEEMLSGRHHYPF
DKELCLERERCALACWRFNNLTTPPANGVSPDERARLFLEILQPRDPVRVSPNEASPVTNVGRVGRHVAVETPFT
CDYGYNISIGHHVVIGRNCTVNDVCEVKIGDNCVIGPNVSIFTASLPIDPKKRQGGQGPQLGKPVTIEQDCWIGG
GAIILPGRTVGKGSTVGAGSIVTKDVPPFTVVAGNPARVLRGIGVAP*
Coding >Ophun1|1401
ATGTCTACCTTTACAGCCCTCAATGGGTCATCGCCCAAGACGACGGACCAGGACGCGCCAACGCCAAAGCCCCGG
ACCTCACCCGACGACACCTGGCGCCCGCTCTCCTCTCACAAGAGGAAGCGCTCCGGCTCCCCCGATCCGAAGCCG
GCCACGCCTCCGAGAGGCTTCCGTCCCGCCAGCGAAGACGCCGAGTATCGCGACGACAGAGCCGCCTACGACGCC
CGCCGCCGCTCGCCCTCACCGAACCAGGACGGTCAGCCCGCAGACCCCCTGCGCCCCCAGCTGGATCAGCACAGC
GACTACAGCCATACGAGCCCCGACGCCGAAGACCGTTCAGCGCCCCTGTACGGCAGCCCCTACGCCGCCGAGCAC
GGCCAGGACTCGGCGCCCCAGCACGACGCCAAGAAGCGGAAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGC
CTGACGTGCCGCAAGCGCAAGAAGAAGTGCGACGAGCACAAGCCCGAGTGCAGCAACTGCGTCCGCGGCGGCTTC
GTCTGCGCCGGCTACCCGCCTCAGAGGGGCCCGGGCTGGCAGAAGCCCGACAGCAAGACGGCCGCCGTCCCGCTC
GAGTCCAAGGATCCGACCTACGTGCCGCCCGGCGCCTACGGCATGCCCCAACCCTCGGCCTACGGACCGACCCAG
TCCGTCAAGCGGGAGCCCCTGCCGCACTACCGCGGTCAGGCCCTCCGCATCGATCCGCCCCAGGGCCGGCCGCTG
GCCGCCTCGGACGACGACCGGCCAACGGCCTCTTCGCTGGCCAGCGCCTCGGCCACCAGCCCCGAGACGAAGCTA
TCGGCGGTCGCTTTCGCGCCCAGCAGCAGCGTCTTCCCCACGCCCGTCAGCGCCAACACGGCCTTTGGCGAGAGG
ATGGCCAAGGAATATCCGCGCGTGCCGCCGCTGCACGACGCGGGTCGCGAGCCCGACACGCCCCACGCGCTGCCG
CAGATCAACATCCTGCACCCGACGCGCGCCAGCAGTCCGACGCCGTCGAGCGCCCAGGTGGCGGCTCAGCTGGCG
CTGTCGCACCCGCAGTACCCTCAGCGGAGGACGCAGAAGGAGGAGATGCTGTCCGGGCGTCACCACTATCCCTTT
GACAAGGAGCTCTGTCTCGAGCGTGAGCGCTGCGCCCTCGCCTGCTGGCGCTTCAACAACCTGACGACTCCGCCC
GCCAACGGCGTCTCGCCCGACGAGCGCGCCCGCCTCTTCCTCGAGATCCTTCAGCCGCGCGATCCCGTCCGCGTC
TCTCCCAACGAGGCATCCCCCGTGACCAACGTCGGCCGCGTCGGTCGCCACGTGGCCGTCGAGACGCCCTTTACG
TGCGACTACGGCTACAACATCTCCATCGGTCACCACGTCGTCATCGGCCGGAACTGCACCGTCAACGACGTCTGC
GAGGTCAAGATTGGCGACAACTGCGTCATCGGGCCCAACGTCAGCATCTTTACCGCCTCGCTGCCCATCGATCCC
AAGAAGCGCCAGGGCGGACAGGGGCCGCAGCTGGGTAAGCCCGTCACCATCGAGCAGGACTGCTGGATCGGAGGA
GGAGCCATCATCCTGCCGGGGCGCACCGTCGGCAAGGGGAGCACCGTCGGCGCCGGCTCCATCGTCACCAAGGAC
GTGCCGCCTTTTACCGTCGTGGCGGGCAATCCTGCTCGCGTCCTCCGCGGCATCGGCGTCGCGCCCTGA
Transcript >Ophun1|1401
ATGTCTACCTTTACAGCCCTCAATGGGTCATCGCCCAAGACGACGGACCAGGACGCGCCAACGCCAAAGCCCCGG
ACCTCACCCGACGACACCTGGCGCCCGCTCTCCTCTCACAAGAGGAAGCGCTCCGGCTCCCCCGATCCGAAGCCG
GCCACGCCTCCGAGAGGCTTCCGTCCCGCCAGCGAAGACGCCGAGTATCGCGACGACAGAGCCGCCTACGACGCC
CGCCGCCGCTCGCCCTCACCGAACCAGGACGGTCAGCCCGCAGACCCCCTGCGCCCCCAGCTGGATCAGCACAGC
GACTACAGCCATACGAGCCCCGACGCCGAAGACCGTTCAGCGCCCCTGTACGGCAGCCCCTACGCCGCCGAGCAC
GGCCAGGACTCGGCGCCCCAGCACGACGCCAAGAAGCGGAAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGC
CTGACGTGCCGCAAGCGCAAGAAGAAGTGCGACGAGCACAAGCCCGAGTGCAGCAACTGCGTCCGCGGCGGCTTC
GTCTGCGCCGGCTACCCGCCTCAGAGGGGCCCGGGCTGGCAGAAGCCCGACAGCAAGACGGCCGCCGTCCCGCTC
GAGTCCAAGGATCCGACCTACGTGCCGCCCGGCGCCTACGGCATGCCCCAACCCTCGGCCTACGGACCGACCCAG
TCCGTCAAGCGGGAGCCCCTGCCGCACTACCGCGGTCAGGCCCTCCGCATCGATCCGCCCCAGGGCCGGCCGCTG
GCCGCCTCGGACGACGACCGGCCAACGGCCTCTTCGCTGGCCAGCGCCTCGGCCACCAGCCCCGAGACGAAGCTA
TCGGCGGTCGCTTTCGCGCCCAGCAGCAGCGTCTTCCCCACGCCCGTCAGCGCCAACACGGCCTTTGGCGAGAGG
ATGGCCAAGGAATATCCGCGCGTGCCGCCGCTGCACGACGCGGGTCGCGAGCCCGACACGCCCCACGCGCTGCCG
CAGATCAACATCCTGCACCCGACGCGCGCCAGCAGTCCGACGCCGTCGAGCGCCCAGGTGGCGGCTCAGCTGGCG
CTGTCGCACCCGCAGTACCCTCAGCGGAGGACGCAGAAGGAGGAGATGCTGTCCGGGCGTCACCACTATCCCTTT
GACAAGGAGCTCTGTCTCGAGCGTGAGCGCTGCGCCCTCGCCTGCTGGCGCTTCAACAACCTGACGACTCCGCCC
GCCAACGGCGTCTCGCCCGACGAGCGCGCCCGCCTCTTCCTCGAGATCCTTCAGCCGCGCGATCCCGTCCGCGTC
TCTCCCAACGAGGCATCCCCCGTGACCAACGTCGGCCGCGTCGGTCGCCACGTGGCCGTCGAGACGCCCTTTACG
TGCGACTACGGCTACAACATCTCCATCGGTCACCACGTCGTCATCGGCCGGAACTGCACCGTCAACGACGTCTGC
GAGGTCAAGATTGGCGACAACTGCGTCATCGGGCCCAACGTCAGCATCTTTACCGCCTCGCTGCCCATCGATCCC
AAGAAGCGCCAGGGCGGACAGGGGCCGCAGCTGGGTAAGCCCGTCACCATCGAGCAGGACTGCTGGATCGGAGGA
GGAGCCATCATCCTGCCGGGGCGCACCGTCGGCAAGGGGAGCACCGTCGGCGCCGGCTCCATCGTCACCAAGGAC
GTGCCGCCTTTTACCGTCGTGGCGGGCAATCCTGCTCGCGTCCTCCGCGGCATCGGCGTCGCGCCCTGA
Gene >Ophun1|1401
ATGTCTACCTTTACAGCCCTCAATGGGTCATCGCCCAAGACGACGGACCAGGACGCGCCAACGCCAAAGCCCCGG
ACCTCACCCGACGACACCTGGCGCCCGCTCTCCTCTCACAAGAGGAAGCGCTCCGGCTCCCCCGATCCGAAGCCG
GCCACGCCTCCGAGAGGCTTCCGTCCCGCCAGCGAAGACGCCGAGTATCGCGACGACAGAGCCGCCTACGACGCC
CGCCGCCGCTCGCCCTCACCGAACCAGGACGGTCAGCCCGCAGACCCCCTGCGCCCCCAGCTGGATCAGCACAGC
GACTACAGCCATACGAGCCCCGACGCCGAAGACCGTTCAGCGCCCCTGTACGGCAGCCCCTACGCCGCCGAGCAC
GGCCAGGACTCGGCGCCCCAGCACGACGCCAAGAAGCGGAAGCGCAACTTCAGCAACCGCACCAAGACGGGCTGC
CTGACGTGCCGCAAGCGCAAGAAGAAGTGCGACGAGCACAAGCCCGAGTGCAGCAACTGCGTCCGCGGCGGCTTC
GTCTGCGCCGGCTACCCGCCTCAGAGGGGCCCGGGCTGGCAGAAGCCCGACAGCAAGACGGCCGCCGTCCCGCTC
GAGTCCAAGGATCCGACCTACGTGCCGCCCGGCGCCTACGGCATGCCCCAACCCTCGGCCTACGGACCGACCCAG
TCCGTCAAGCGGGAGCCCCTGCCGCACTACCGCGGTCAGGCCCTCCGCATCGATCCGCCCCAGGGCCGGCCGCTG
GCCGCCTCGGACGACGACCGGCCAACGGCCTCTTCGCTGGCCAGCGCCTCGGCCACCAGCCCCGAGACGAAGCTA
TCGGCGGTCGCTTTCGCGCCCAGCAGCAGCGTCTTCCCCACGCCCGTCAGCGCCAACACGGCCTTTGGCGAGAGG
ATGGCCAAGGAATATCCGCGCGTGCCGCCGCTGCACGACGCGGGTCGCGAGCCCGACACGCCCCACGCGCTGCCG
CAGATCAACATCCTGCACCCGACGCGCGCCAGCAGTCCGACGCCGTCGAGCGCCCAGGTGGCGGCTCAGCTGGCG
CTGTCGCACCCGCAGTACCCTCAGCGGAGGACGCAGAAGGAGGAGATGCTGTCCGGGCGTCACCACTATCCCTTT
GACAAGGAGCTCTGTCTCGAGCGTGAGCGCTGCGCCCTCGCCTGCTGGCGCTTCAACAACCTGACGACTCCGCCC
GCCAACGGCGTCTCGCCCGACGAGCGCGCCCGCCTCTTCCTCGAGATCCTTCAGCCGCGCGATCCCGTCCGCGTC
TCTCCCAACGAGGCATCCCCCGTGACCAACGTCGGCCGCGTCGGTCGCCACGTGGCCGTCGAGACGCCCTTTACG
TGCGACTACGGCTACAACATCTCCATCGGTCACCACGTCGTCATCGGCCGGAACTGCACCGTCAACGACGTCTGC
GAGGTCAAGATTGGCGACAACTGCGTCATCGGGCCCAACGTCAGCATCTTTACCGCCTCGCTGCCCATCGATCCC
AAGAAGCGCCAGGGCGGACAGGGGCCGCAGCTGGGTAAGCCCGTCACCATCGAGCAGGACTGCTGGATCGGAGGA
GGAGCCATCATCCTGCCGGGGCGCACCGTCGGCAAGGGGAGCACCGTCGGCGCCGGCTCCATCGTCACCAAGGTT
CGTCTCATGTTGGCCGACTCGGCCTCTCCTCGACTGACTCTTGGTAGGACGTGCCGCCTTTTACCGTCGTGGCGG
GCAATCCTGCTCGCGTCCTCCGCGGCATCGGCGTCGCGCCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail