Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1392
Gene name
LocationContig_156:23428..24520
Strand+
Gene length (bp)1092
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01504 PIP5K Phosphatidylinositol-4-phosphate 5-Kinase 1.1E-38 87 351

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016307 phosphatidylinositol phosphate kinase activity Yes
GO:0046488 phosphatidylinositol metabolic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0006629 lipid metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008152 metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016301 kinase activity No
GO:0016740 transferase activity No
GO:0006650 glycerophospholipid metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0019637 organophosphate metabolic process No
GO:0008150 biological_process No
GO:0046486 glycerolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1392
MKIRSRRISASIADAIAAPADDEDVGHSPCFGRCLNTLSAFSALYRLDLAQYRPVDFLRLRRDVWQLDEASYRRS
FDGPSDHDDAARQLMPVGDLGYSGSTFFSTPDGGYLVKSLPRRFEHEFFTHDLLDVYMARMMDCPESLLVRITDM
VFSPKATLGGILGTAPTHHIIMENLLHLGGDGRDEQQDVAAETYDLKPDDYFFPERDIADGRLVPASIKDRLVDS
FPDEVRVSARARRELISLLEADTALLADKSAVDYSLFLVRFPVTTDSPFSDSNATQSSWRTGIASTDGRWIYRAV
VLDFFWAKKKLRAKAMTGLVGALNLVARKGPMSITAEPAEYRARFLRMVNKLVSSDDDDGAES*
Coding >Ophun1|1392
ATGAAGATCCGCTCGCGCCGCATCTCGGCTAGCATCGCCGACGCCATCGCGGCGCCTGCTGACGATGAAGACGTC
GGCCACAGCCCGTGCTTCGGCCGCTGCCTCAATACTCTGAGTGCCTTCTCGGCGCTGTATCGCCTCGACCTCGCG
CAATATCGACCGGTCGACTTCCTTCGCTTGCGCCGCGACGTCTGGCAGCTGGACGAGGCGTCGTATCGTCGATCC
TTTGACGGCCCTTCTGATCACGATGACGCGGCTCGACAGCTCATGCCCGTCGGCGACCTCGGCTACAGCGGGTCG
ACCTTTTTCTCGACGCCCGATGGCGGCTACCTCGTCAAGTCGCTACCACGGCGGTTCGAGCACGAGTTCTTTACC
CATGACCTGCTCGATGTATACATGGCTCGCATGATGGACTGCCCCGAGAGTTTACTGGTGCGCATCACCGACATG
GTCTTTAGCCCGAAAGCCACGCTGGGTGGCATCCTGGGGACGGCGCCGACTCATCACATCATCATGGAGAACCTT
CTTCACCTGGGGGGTGACGGCCGTGATGAACAGCAAGATGTTGCGGCTGAGACGTACGACCTGAAACCAGACGAC
TACTTTTTCCCCGAGCGAGACATCGCCGATGGGAGGCTGGTGCCAGCGAGCATCAAGGACCGCCTCGTCGATAGC
TTCCCCGATGAAGTGCGCGTATCAGCCAGGGCGAGACGCGAGCTTATCTCGCTGCTTGAAGCCGACACAGCTCTT
CTAGCTGATAAGAGCGCTGTCGACTACTCTCTGTTCCTCGTCCGCTTCCCCGTCACGACAGACTCACCCTTTTCC
GACTCAAACGCGACGCAAAGCTCGTGGCGCACGGGTATCGCCTCTACCGACGGCCGCTGGATCTACCGCGCCGTA
GTGCTTGACTTTTTCTGGGCCAAGAAGAAGCTGCGGGCCAAGGCCATGACGGGTCTGGTTGGAGCACTAAACCTG
GTTGCGAGAAAAGGACCCATGAGCATCACGGCGGAACCGGCCGAGTACAGAGCCCGCTTCCTGAGAATGGTGAAT
AAGCTGGTCTCAAGTGATGACGATGATGGGGCCGAGTCGTAG
Transcript >Ophun1|1392
ATGAAGATCCGCTCGCGCCGCATCTCGGCTAGCATCGCCGACGCCATCGCGGCGCCTGCTGACGATGAAGACGTC
GGCCACAGCCCGTGCTTCGGCCGCTGCCTCAATACTCTGAGTGCCTTCTCGGCGCTGTATCGCCTCGACCTCGCG
CAATATCGACCGGTCGACTTCCTTCGCTTGCGCCGCGACGTCTGGCAGCTGGACGAGGCGTCGTATCGTCGATCC
TTTGACGGCCCTTCTGATCACGATGACGCGGCTCGACAGCTCATGCCCGTCGGCGACCTCGGCTACAGCGGGTCG
ACCTTTTTCTCGACGCCCGATGGCGGCTACCTCGTCAAGTCGCTACCACGGCGGTTCGAGCACGAGTTCTTTACC
CATGACCTGCTCGATGTATACATGGCTCGCATGATGGACTGCCCCGAGAGTTTACTGGTGCGCATCACCGACATG
GTCTTTAGCCCGAAAGCCACGCTGGGTGGCATCCTGGGGACGGCGCCGACTCATCACATCATCATGGAGAACCTT
CTTCACCTGGGGGGTGACGGCCGTGATGAACAGCAAGATGTTGCGGCTGAGACGTACGACCTGAAACCAGACGAC
TACTTTTTCCCCGAGCGAGACATCGCCGATGGGAGGCTGGTGCCAGCGAGCATCAAGGACCGCCTCGTCGATAGC
TTCCCCGATGAAGTGCGCGTATCAGCCAGGGCGAGACGCGAGCTTATCTCGCTGCTTGAAGCCGACACAGCTCTT
CTAGCTGATAAGAGCGCTGTCGACTACTCTCTGTTCCTCGTCCGCTTCCCCGTCACGACAGACTCACCCTTTTCC
GACTCAAACGCGACGCAAAGCTCGTGGCGCACGGGTATCGCCTCTACCGACGGCCGCTGGATCTACCGCGCCGTA
GTGCTTGACTTTTTCTGGGCCAAGAAGAAGCTGCGGGCCAAGGCCATGACGGGTCTGGTTGGAGCACTAAACCTG
GTTGCGAGAAAAGGACCCATGAGCATCACGGCGGAACCGGCCGAGTACAGAGCCCGCTTCCTGAGAATGGTGAAT
AAGCTGGTCTCAAGTGATGACGATGATGGGGCCGAGTCGTAG
Gene >Ophun1|1392
ATGAAGATCCGCTCGCGCCGCATCTCGGCTAGCATCGCCGACGCCATCGCGGCGCCTGCTGACGATGAAGACGTC
GGCCACAGCCCGTGCTTCGGCCGCTGCCTCAATACTCTGAGTGCCTTCTCGGCGCTGTATCGCCTCGACCTCGCG
CAATATCGACCGGTCGACTTCCTTCGCTTGCGCCGCGACGTCTGGCAGCTGGACGAGGCGTCGTATCGTCGATCC
TTTGACGGCCCTTCTGATCACGATGACGCGGCTCGACAGCTCATGCCCGTCGGCGACCTCGGCTACAGCGGGTCG
ACCTTTTTCTCGACGCCCGATGGCGGCTACCTCGTCAAGTCGCTACCACGGCGGTTCGAGCACGAGTTCTTTACC
CATGACCTGCTCGATGTATACATGGCTCGCATGATGGACTGCCCCGAGAGTTTACTGGTGCGCATCACCGACATG
GTCTTTAGCCCGAAAGCCACGCTGGGTGGCATCCTGGGGACGGCGCCGACTCATCACATCATCATGGAGAACCTT
CTTCACCTGGGGGGTGACGGCCGTGATGAACAGCAAGATGTTGCGGCTGAGACGTACGACCTGAAACCAGACGAC
TACTTTTTCCCCGAGCGAGACATCGCCGATGGGAGGCTGGTGCCAGCGAGCATCAAGGACCGCCTCGTCGATAGC
TTCCCCGATGAAGTGCGCGTATCAGCCAGGGCGAGACGCGAGCTTATCTCGCTGCTTGAAGCCGACACAGCTCTT
CTAGCTGATAAGAGCGCTGTCGACTACTCTCTGTTCCTCGTCCGCTTCCCCGTCACGACAGACTCACCCTTTTCC
GACTCAAACGCGACGCAAAGCTCGTGGCGCACGGGTATCGCCTCTACCGACGGCCGCTGGATCTACCGCGCCGTA
GTGCTTGACTTTTTCTGGGCCAAGAAGAAGCTGCGGGCCAAGGCCATGACGGGTCTGGTTGGAGCACTAAACCTG
GTTGCGAGAAAAGGACCCATGAGCATCACGGCGGAACCGGCCGAGTACAGAGCCCGCTTCCTGAGAATGGTGAAT
AAGCTGGTCTCAAGTGATGACGATGATGGGGCCGAGTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail