Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1374
Gene name
LocationContig_155:3264..7922
Strand-
Gene length (bp)4658
Transcript length (bp)3534
Coding sequence length (bp)3534
Protein length (aa) 1178

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00022 Actin Actin 5.3E-100 793 1173
PF00083 Sugar_tr Sugar (and other) transporter 1.7E-85 330 794
PF07690 MFS_1 Major Facilitator Superfamily 6.7E-28 380 746
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 1.0E-05 386 545

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 795 1177 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 795 1177 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 789 1175 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 792 1175 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 795 1173 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUJ1|ARP2_SCHPO Actin-related protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp2 PE=1 SV=1 795 1177 0.0E+00
sp|P32381|ARP2_YEAST Actin-related protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP2 PE=1 SV=1 795 1177 0.0E+00
sp|P53488|ARP2_CHICK Actin-related protein 2 OS=Gallus gallus GN=ACTR2 PE=2 SV=1 789 1175 0.0E+00
sp|Q7ZTP2|ARP2A_XENLA Actin-related protein 2-A OS=Xenopus laevis GN=actr2-a PE=2 SV=1 792 1175 0.0E+00
sp|P53487|ARP2_ACACA Actin-related protein 2 OS=Acanthamoeba castellanii GN=arp2 PE=2 SV=1 795 1173 0.0E+00
sp|Q7ZXV3|ARP2B_XENLA Actin-related protein 2-B OS=Xenopus laevis GN=actr2-b PE=2 SV=1 792 1175 0.0E+00
sp|Q5M7U6|ARP2_RAT Actin-related protein 2 OS=Rattus norvegicus GN=Actr2 PE=2 SV=1 792 1175 0.0E+00
sp|Q5R4K0|ARP2_PONAB Actin-related protein 2 OS=Pongo abelii GN=ACTR2 PE=2 SV=1 792 1175 0.0E+00
sp|P61161|ARP2_MOUSE Actin-related protein 2 OS=Mus musculus GN=Actr2 PE=1 SV=1 792 1175 0.0E+00
sp|P61160|ARP2_HUMAN Actin-related protein 2 OS=Homo sapiens GN=ACTR2 PE=1 SV=1 792 1175 0.0E+00
sp|A7MB62|ARP2_BOVIN Actin-related protein 2 OS=Bos taurus GN=ACTR2 PE=1 SV=1 792 1175 0.0E+00
sp|Q5BL41|ARP2_XENTR Actin-related protein 2 OS=Xenopus tropicalis GN=actr2 PE=2 SV=1 792 1175 0.0E+00
sp|Q7SXW6|ARP2A_DANRE Actin-related protein 2-A OS=Danio rerio GN=actr2a PE=2 SV=1 792 1175 0.0E+00
sp|Q56A35|ARP2B_DANRE Actin-related protein 2-B OS=Danio rerio GN=actr2b PE=2 SV=1 792 1175 0.0E+00
sp|P45888|ARP2_DROME Actin-related protein 2 OS=Drosophila melanogaster GN=Arp2 PE=2 SV=3 795 1174 5.0E-180
sp|O96621|ARP2_DICDI Actin-related protein 2 OS=Dictyostelium discoideum GN=arpB PE=1 SV=1 795 1174 9.0E-179
sp|P53489|ARP2_CAEEL Actin-related protein 2 OS=Caenorhabditis elegans GN=arx-2 PE=3 SV=1 789 1177 3.0E-172
sp|Q61JZ2|ARP2_CAEBR Actin-related protein 2 OS=Caenorhabditis briggsae GN=arx-2 PE=3 SV=1 789 1177 1.0E-168
sp|Q9LSD6|ARP2_ARATH Actin-related protein 2 OS=Arabidopsis thaliana GN=ARP2 PE=1 SV=1 795 1174 6.0E-154
sp|Q6Z256|ARP2_ORYSJ Actin-related protein 2 OS=Oryza sativa subsp. japonica GN=ARP2 PE=3 SV=1 795 1175 4.0E-152
sp|A2YUL5|ARP2_ORYSI Actin-related protein 2 OS=Oryza sativa subsp. indica GN=ARP2 PE=3 SV=2 795 1175 5.0E-152
sp|O18499|ACT1_SACKO Actin-1 OS=Saccoglossus kowalevskii PE=2 SV=1 789 1173 5.0E-109
sp|P10365|ACT_THELA Actin OS=Thermomyces lanuginosus PE=3 SV=1 787 1173 8.0E-109
sp|O18500|ACT2_SACKO Actin-2 OS=Saccoglossus kowalevskii PE=2 SV=1 789 1173 1.0E-108
sp|P53492|ACT7_ARATH Actin-7 OS=Arabidopsis thaliana GN=ACT7 PE=1 SV=1 789 1173 2.0E-108
sp|P02578|ACT1_ACACA Actin-1 OS=Acanthamoeba castellanii PE=1 SV=1 795 1173 2.0E-108
sp|P53505|ACT5_XENLA Actin, cytoplasmic type 5 OS=Xenopus laevis PE=3 SV=1 789 1173 2.0E-108
sp|A2BDB0|ACTG_XENLA Actin, cytoplasmic 2 OS=Xenopus laevis GN=actg1 PE=2 SV=1 787 1173 2.0E-108
sp|P63257|ACTG_TRIVU Actin, cytoplasmic 2 OS=Trichosurus vulpecula GN=ACTG1 PE=2 SV=1 787 1173 2.0E-108
sp|P63259|ACTG_RAT Actin, cytoplasmic 2 OS=Rattus norvegicus GN=Actg1 PE=1 SV=1 787 1173 2.0E-108
sp|P63260|ACTG_MOUSE Actin, cytoplasmic 2 OS=Mus musculus GN=Actg1 PE=1 SV=1 787 1173 2.0E-108
sp|P63261|ACTG_HUMAN Actin, cytoplasmic 2 OS=Homo sapiens GN=ACTG1 PE=1 SV=1 787 1173 2.0E-108
sp|Q5ZMQ2|ACTG_CHICK Actin, cytoplasmic 2 OS=Gallus gallus GN=ACTG1 PE=1 SV=1 787 1173 2.0E-108
sp|P63258|ACTG_BOVIN Actin, cytoplasmic 2 OS=Bos taurus GN=ACTG1 PE=1 SV=1 787 1173 2.0E-108
sp|P53457|ACT3_DIPDE Actin-3 OS=Diphyllobothrium dendriticum GN=ACT3 PE=2 SV=1 786 1173 3.0E-108
sp|Q5JAK2|ACTG_PELLE Actin, cytoplasmic 2 OS=Pelophylax lessonae GN=actg1 PE=2 SV=1 789 1173 3.0E-108
sp|O65315|ACT_COLSC Actin OS=Coleochaete scutata PE=2 SV=1 789 1173 3.0E-108
sp|P53470|ACT1_SCHMA Actin-1 OS=Schistosoma mansoni PE=2 SV=1 789 1173 3.0E-108
sp|P11426|ACT_ENTHI Actin OS=Entamoeba histolytica PE=2 SV=1 789 1173 3.0E-108
sp|Q0PGG4|ACTB_BOSMU Actin, cytoplasmic 1 OS=Bos mutus grunniens GN=ACTB PE=2 SV=1 789 1173 3.0E-108
sp|Q6P378|ACTG_XENTR Actin, cytoplasmic 2 OS=Xenopus tropicalis GN=actg1 PE=2 SV=1 789 1173 4.0E-108
sp|P30163|ACT2_ONCVO Actin-2 OS=Onchocerca volvulus GN=act-2b PE=3 SV=1 789 1173 4.0E-108
sp|P53458|ACT5_DIPDE Actin-5 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT5 PE=2 SV=1 795 1173 4.0E-108
sp|Q7ZVI7|ACTB1_DANRE Actin, cytoplasmic 1 OS=Danio rerio GN=actba PE=2 SV=2 789 1173 4.0E-108
sp|P53478|ACT5_CHICK Actin, cytoplasmic type 5 OS=Gallus gallus PE=3 SV=1 789 1173 4.0E-108
sp|A3C6D7|ACT2_ORYSJ Actin-2 OS=Oryza sativa subsp. japonica GN=ACT2 PE=2 SV=1 789 1173 5.0E-108
sp|P0C539|ACT2_ORYSI Actin-2 OS=Oryza sativa subsp. indica GN=ACT2 PE=3 SV=1 789 1173 5.0E-108
sp|P15475|ACTB_XENBO Actin, cytoplasmic 1 OS=Xenopus borealis GN=actb PE=3 SV=1 789 1173 5.0E-108
sp|P48975|ACTB_CRIGR Actin, cytoplasmic 1 OS=Cricetulus griseus GN=ACTB PE=3 SV=1 789 1173 5.0E-108
sp|P30162|ACT1_ONCVO Actin-1 OS=Onchocerca volvulus GN=act-1a PE=3 SV=1 789 1173 6.0E-108
sp|P53485|ACTB2_TAKRU Actin, cytoplasmic 2 OS=Takifugu rubripes GN=actbb PE=3 SV=1 789 1173 6.0E-108
sp|P0CJ47|ACT3_ARATH Actin-3 OS=Arabidopsis thaliana GN=ACT3 PE=1 SV=1 789 1173 7.0E-108
sp|P0CJ46|ACT1_ARATH Actin-1 OS=Arabidopsis thaliana GN=ACT1 PE=1 SV=1 789 1173 7.0E-108
sp|P53459|ACT6_DIPDE Actin-6 (Fragment) OS=Diphyllobothrium dendriticum GN=ACT6 PE=2 SV=1 789 1173 8.0E-108
sp|Q964D9|ACTC_PLATR Actin, cytoplasmic OS=Planorbella trivolvis PE=3 SV=1 789 1173 8.0E-108
sp|P07837|ACT2_BOMMO Actin, muscle-type A2 OS=Bombyx mori PE=3 SV=1 789 1173 9.0E-108
sp|Q964E1|ACTC_BIOOB Actin, cytoplasmic OS=Biomphalaria obstructa PE=3 SV=1 789 1173 1.0E-107
sp|P60707|ACTB_TRIVU Actin, cytoplasmic 1 OS=Trichosurus vulpecula GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|Q4L0Y2|ACTB_SPECI Actin, cytoplasmic 1 OS=Spermophilus citellus GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P60713|ACTB_SHEEP Actin, cytoplasmic 1 OS=Ovis aries GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P60711|ACTB_RAT Actin, cytoplasmic 1 OS=Rattus norvegicus GN=Actb PE=1 SV=1 789 1173 1.0E-107
sp|Q5R6G0|ACTB_PONAB Actin, cytoplasmic 1 OS=Pongo abelii GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|Q6QAQ1|ACTB_PIG Actin, cytoplasmic 1 OS=Sus scrofa GN=ACTB PE=1 SV=2 789 1173 1.0E-107
sp|Q5R1X3|ACTB_PANTR Actin, cytoplasmic 1 OS=Pan troglodytes GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P60710|ACTB_MOUSE Actin, cytoplasmic 1 OS=Mus musculus GN=Actb PE=1 SV=1 789 1173 1.0E-107
sp|Q711N9|ACTB_MESAU Actin, cytoplasmic 1 OS=Mesocricetus auratus GN=ACTB PE=1 SV=1 789 1173 1.0E-107
sp|Q4R561|ACTB_MACFA Actin, cytoplasmic 1 OS=Macaca fascicularis GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P60709|ACTB_HUMAN Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1 789 1173 1.0E-107
sp|P60708|ACTB_HORSE Actin, cytoplasmic 1 OS=Equus caballus GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|Q76N69|ACTB_CHLAE Actin, cytoplasmic 1 OS=Chlorocebus aethiops GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P60706|ACTB_CHICK Actin, cytoplasmic 1 OS=Gallus gallus GN=ACTB PE=1 SV=1 789 1173 1.0E-107
sp|Q71FK5|ACTB_CAVPO Actin, cytoplasmic 1 OS=Cavia porcellus GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|O18840|ACTB_CANLF Actin, cytoplasmic 1 OS=Canis lupus familiaris GN=ACTB PE=2 SV=3 789 1173 1.0E-107
sp|P60712|ACTB_BOVIN Actin, cytoplasmic 1 OS=Bos taurus GN=ACTB PE=1 SV=1 789 1173 1.0E-107
sp|P10986|ACT4_CAEEL Actin-4 OS=Caenorhabditis elegans GN=act-4 PE=3 SV=2 789 1173 1.0E-107
sp|Q8JJB8|ACTG_TRISC Actin, cytoplasmic 2 OS=Triakis scyllium GN=actg1 PE=2 SV=1 789 1173 1.0E-107
sp|P63256|ACTG_ANSAN Actin, cytoplasmic 2 OS=Anser anser anser GN=ACTG1 PE=2 SV=1 787 1173 1.0E-107
sp|P84336|ACTB_CAMDR Actin, cytoplasmic 1 OS=Camelus dromedarius GN=ACTB PE=1 SV=1 789 1173 1.0E-107
sp|P29751|ACTB_RABIT Actin, cytoplasmic 1 OS=Oryctolagus cuniculus GN=ACTB PE=2 SV=1 789 1173 1.0E-107
sp|P0C540|ACT7_ORYSJ Actin-7 OS=Oryza sativa subsp. japonica GN=ACT7 PE=3 SV=1 789 1171 1.0E-107
sp|P0C542|ACT7_ORYSI Actin-7 OS=Oryza sativa subsp. indica GN=ACT7 PE=3 SV=1 789 1171 1.0E-107
sp|P83750|ACTB_CYPCA Actin, cytoplasmic 1 OS=Cyprinus carpio GN=actb PE=3 SV=1 789 1173 1.0E-107
sp|P83751|ACTB_CTEID Actin, cytoplasmic 1 OS=Ctenopharyngodon idella GN=actb PE=3 SV=1 789 1173 1.0E-107
sp|Q7ZVF9|ACTB2_DANRE Actin, cytoplasmic 2 OS=Danio rerio GN=actbb PE=2 SV=2 789 1173 1.0E-107
sp|P69005|ACTD_STRPU Actin, cytoskeletal 2B OS=Strongylocentrotus purpuratus GN=CYIIB PE=2 SV=1 789 1173 1.0E-107
sp|P45886|ACT3_BACDO Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 789 1173 1.0E-107
sp|P69004|ACT2_STRFN Actin-15B OS=Strongylocentrotus franciscanus PE=2 SV=1 789 1173 1.0E-107
sp|P53472|ACTA_STRPU Actin, cytoskeletal 1A OS=Strongylocentrotus purpuratus GN=CYIA PE=3 SV=1 789 1173 1.0E-107
sp|Q8X119|ACT_EXODE Actin OS=Exophiala dermatitidis PE=3 SV=1 789 1173 1.0E-107
sp|P69003|ACT1_HELTB Actin CyI, cytoplasmic OS=Heliocidaris tuberculata PE=3 SV=1 789 1173 1.0E-107
sp|P69002|ACT1_HELER Actin CyI, cytoplasmic OS=Heliocidaris erythrogramma PE=3 SV=1 789 1173 1.0E-107
sp|P53506|ACT8_XENLA Actin, cytoplasmic type 8 OS=Xenopus laevis PE=3 SV=1 789 1173 2.0E-107
sp|Q964E3|ACTC_BIOAL Actin, cytoplasmic OS=Biomphalaria alexandrina PE=3 SV=1 789 1173 2.0E-107
sp|P45885|ACT2_BACDO Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 789 1173 2.0E-107
sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 789 1173 2.0E-107
sp|Q964E0|ACTC_BIOTE Actin, cytoplasmic OS=Biomphalaria tenagophila PE=3 SV=1 789 1173 2.0E-107
sp|P18603|ACT4_ARTSX Actin, clone 403 OS=Artemia sp. PE=2 SV=1 789 1173 2.0E-107
sp|Q964E2|ACTC_BIOPF Actin, cytoplasmic OS=Biomphalaria pfeifferi PE=3 SV=1 789 1173 2.0E-107
sp|P0DM42|ACT3_CAEEL Actin-3 OS=Caenorhabditis elegans GN=act-3 PE=1 SV=1 789 1173 2.0E-107
sp|P0DM41|ACT1_CAEEL Actin-1 OS=Caenorhabditis elegans GN=act-1 PE=1 SV=1 789 1173 2.0E-107
sp|P53464|ACTM_HELTB Actin, cytoskeletal OS=Heliocidaris tuberculata PE=3 SV=1 789 1173 2.0E-107
sp|P10981|ACT5_DROME Actin-87E OS=Drosophila melanogaster GN=Act87E PE=1 SV=1 789 1173 2.0E-107
sp|P18600|ACT1_ARTSX Actin, clone 205 OS=Artemia sp. PE=2 SV=1 789 1173 2.0E-107
sp|P53501|ACT3_DROME Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 789 1173 2.0E-107
sp|P49128|ACT1_AEDAE Actin-1 OS=Aedes aegypti GN=ACT-1 PE=2 SV=2 789 1173 2.0E-107
sp|P10990|ACT1_STRFN Actin-15A OS=Strongylocentrotus franciscanus PE=3 SV=1 789 1173 3.0E-107
sp|Q10AZ4|ACT3_ORYSJ Actin-3 OS=Oryza sativa subsp. japonica GN=ACT3 PE=2 SV=1 789 1173 3.0E-107
sp|A2XNS1|ACT3_ORYSI Actin-3 OS=Oryza sativa subsp. indica GN=ACT3 PE=3 SV=2 789 1173 3.0E-107
sp|P53473|ACTB_STRPU Actin, cytoskeletal 1B OS=Strongylocentrotus purpuratus GN=CYIB PE=3 SV=1 789 1173 3.0E-107
sp|P35432|ACT1_ECHGR Actin-1 OS=Echinococcus granulosus GN=ACTI PE=3 SV=1 789 1173 3.0E-107
sp|Q6NVA9|ACTB_XENTR Actin, cytoplasmic 1 OS=Xenopus tropicalis GN=actb PE=2 SV=1 789 1173 3.0E-107
sp|O93400|ACTB_XENLA Actin, cytoplasmic 1 OS=Xenopus laevis GN=actb PE=2 SV=1 789 1173 3.0E-107
sp|P04829|ACT3_BOMMO Actin, cytoplasmic A3 OS=Bombyx mori PE=3 SV=3 789 1173 3.0E-107
sp|P53463|ACTM_HELER Actin, cytoskeletal OS=Heliocidaris erythrogramma PE=3 SV=1 789 1173 4.0E-107
sp|Q91ZK5|ACTB_SIGHI Actin, cytoplasmic 1 OS=Sigmodon hispidus GN=ACTB PE=2 SV=1 789 1173 4.0E-107
sp|P53486|ACTB3_TAKRU Actin, cytoplasmic 3 OS=Takifugu rubripes GN=actbc PE=2 SV=1 789 1173 4.0E-107
sp|O42161|ACTB_SALSA Actin, cytoplasmic 1 OS=Salmo salar GN=actb PE=2 SV=1 787 1173 4.0E-107
sp|P12716|ACTC_PISOC Actin, cytoplasmic OS=Pisaster ochraceus PE=3 SV=1 789 1173 4.0E-107
sp|Q05214|ACT1_TOBAC Actin OS=Nicotiana tabacum PE=3 SV=1 789 1173 4.0E-107
sp|P10989|ACT_SCHPO Actin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act1 PE=1 SV=1 787 1171 5.0E-107
sp|P26183|ACT_CRYPV Actin OS=Cryptosporidium parvum PE=3 SV=1 795 1173 5.0E-107
sp|Q25010|ACT3A_HELAM Actin, cytoplasmic A3a OS=Helicoverpa armigera GN=actA3a PE=2 SV=1 789 1173 5.0E-107
sp|P02572|ACT2_DROME Actin-42A OS=Drosophila melanogaster GN=Act42A PE=1 SV=3 789 1173 5.0E-107
sp|P92179|ACTC_BIOGL Actin, cytoplasmic OS=Biomphalaria glabrata PE=2 SV=2 789 1173 5.0E-107
sp|P27131|ACT1_NAEFO Actin-1 OS=Naegleria fowleri PE=2 SV=2 795 1173 5.0E-107
sp|P68555|ACT_TAESO Actin OS=Taenia solium GN=ACT1 PE=3 SV=1 789 1173 5.0E-107
sp|P68556|ACT1_DIPDE Actin-1/4 OS=Diphyllobothrium dendriticum GN=ACT1 PE=2 SV=1 789 1173 5.0E-107
sp|P68143|ACTB_OREMO Actin, cytoplasmic 1 OS=Oreochromis mossambicus GN=actb PE=2 SV=1 787 1173 5.0E-107
sp|P68142|ACTB1_TAKRU Actin, cytoplasmic 1 OS=Takifugu rubripes GN=actba PE=2 SV=1 787 1173 5.0E-107
sp|P84185|ACT5C_ANOGA Actin-5C OS=Anopheles gambiae GN=Act5C PE=2 SV=1 789 1173 5.0E-107
sp|P84183|ACT4_BOMMO Actin, cytoplasmic A4 OS=Bombyx mori GN=A4 PE=2 SV=1 789 1173 5.0E-107
sp|P84184|ACT3B_HELAM Actin-A3b, cytoplasmic OS=Helicoverpa armigera GN=actA3b PE=2 SV=1 789 1173 5.0E-107
sp|P10987|ACT1_DROME Actin-5C OS=Drosophila melanogaster GN=Act5C PE=1 SV=4 789 1173 5.0E-107
sp|P20359|ACTG_EMENI Actin, gamma OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acnA PE=3 SV=2 789 1173 6.0E-107
sp|P83968|ACT6_DROSI Actin, indirect flight muscle OS=Drosophila simulans GN=Act88F PE=3 SV=1 789 1173 6.0E-107
sp|P83967|ACT6_DROME Actin, indirect flight muscle OS=Drosophila melanogaster GN=Act88F PE=1 SV=1 789 1173 6.0E-107
sp|P83969|ACT1_BACDO Actin, indirect flight muscle OS=Bactrocera dorsalis PE=3 SV=1 789 1173 6.0E-107
sp|P78711|ACT_NEUCR Actin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=act PE=3 SV=2 789 1173 6.0E-107
sp|Q6TCF2|ACT_GAEGA Actin OS=Gaeumannomyces graminis var. avenae GN=ACT PE=2 SV=1 789 1173 6.0E-107
sp|Q9UVW9|ACTG_ACRCH Actin, gamma OS=Acremonium chrysogenum GN=ACT PE=3 SV=1 789 1173 6.0E-107
sp|P53471|ACT2_SCHMA Actin-2 OS=Schistosoma mansoni PE=2 SV=1 789 1173 6.0E-107
sp|P41339|ACTA_LIMPO Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 789 1173 7.0E-107
sp|Q26065|ACT_PLAMG Actin, adductor muscle OS=Placopecten magellanicus PE=2 SV=1 789 1173 7.0E-107
sp|O17320|ACT_CRAGI Actin OS=Crassostrea gigas PE=2 SV=1 789 1173 7.0E-107
sp|P79818|ACTB_ORYLA Actin, cytoplasmic 1 OS=Oryzias latipes GN=actb PE=2 SV=2 789 1173 7.0E-107
sp|Q9Y707|ACT2_SUIBO Actin-2 OS=Suillus bovinus GN=ACT2 PE=2 SV=1 787 1173 7.0E-107
sp|P53498|ACT_CHLRE Actin OS=Chlamydomonas reinhardtii PE=2 SV=1 791 1173 8.0E-107
sp|Q00215|ACTC_STYPL Actin, cytoplasmic OS=Styela plicata PE=3 SV=1 789 1173 8.0E-107
sp|Q9URS0|ACTG_PENCH Actin, gamma OS=Penicillium chrysogenum GN=ACT PE=3 SV=1 789 1173 1.0E-106
sp|P53456|ACT2_DIPDE Actin-2 OS=Diphyllobothrium dendriticum GN=ACT2 PE=2 SV=1 789 1173 1.0E-106
sp|O13419|ACT_BOTFU Actin OS=Botryotinia fuckeliana GN=actA PE=3 SV=1 789 1173 1.0E-106
sp|P53455|ACT_AJECG Actin OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=HCBG_08711 PE=2 SV=2 789 1173 1.0E-106
sp|P49871|ACT_MANSE Actin, muscle OS=Manduca sexta PE=2 SV=1 789 1173 1.0E-106
sp|O65314|ACT_SCHDU Actin OS=Scherffelia dubia PE=2 SV=1 795 1173 1.0E-106
sp|P17304|ACTM_APLCA Actin, muscle OS=Aplysia californica PE=2 SV=1 789 1173 2.0E-106
sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 789 1173 2.0E-106
sp|Q2U7A3|ACT_ASPOR Actin OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=act1 PE=3 SV=1 795 1173 2.0E-106
sp|Q553U6|ACT22_DICDI Putative actin-22 OS=Dictyostelium discoideum GN=act22 PE=3 SV=1 789 1173 2.0E-106
sp|P41341|ACTY_LIMPO Actin-11 OS=Limulus polyphemus PE=2 SV=1 789 1173 2.0E-106
sp|P26197|ACT2_ABSGL Actin-2 OS=Absidia glauca GN=ACT2 PE=3 SV=1 786 1173 2.0E-106
sp|P48465|ACT_CRYNH Actin OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_00483 PE=3 SV=2 787 1173 2.0E-106
sp|O16808|ACT_MAYDE Actin OS=Mayetiola destructor PE=2 SV=1 789 1173 2.0E-106
sp|P30167|ACT3_SOLTU Actin-58 OS=Solanum tuberosum GN=AC58 PE=3 SV=1 789 1173 2.0E-106
sp|Q03341|ACT2_ECHGR Actin-2 OS=Echinococcus granulosus GN=ACTII PE=3 SV=1 789 1173 2.0E-106
sp|P12717|ACTM_PISOC Actin, muscle OS=Pisaster ochraceus PE=3 SV=1 789 1173 2.0E-106
sp|P49055|ACTS_CARAU Actin, alpha skeletal muscle OS=Carassius auratus GN=acta1 PE=2 SV=1 789 1173 2.0E-106
sp|P02576|ACTA_PHYPO Actin, plasmodial isoform OS=Physarum polycephalum GN=ARDA PE=1 SV=2 789 1173 3.0E-106
sp|P53467|ACTM_MOLOC Actin, larval muscle-type OS=Molgula oculata PE=3 SV=1 795 1173 3.0E-106
sp|P53460|ACT1_HALRO Actin, muscle 1A OS=Halocynthia roretzi GN=MA1A PE=3 SV=1 795 1173 3.0E-106
sp|P04751|ACTC_XENLA Actin, alpha cardiac muscle 1 OS=Xenopus laevis GN=actc1 PE=2 SV=1 795 1173 3.0E-106
sp|Q93131|ACTC_BRAFL Actin, cytoplasmic OS=Branchiostoma floridae PE=2 SV=1 789 1173 3.0E-106
sp|P20399|ACT2_XENTR Actin, alpha cardiac muscle 2 OS=Xenopus tropicalis PE=2 SV=1 795 1173 3.0E-106
sp|P92182|ACT1_LUMTE Actin-1 OS=Lumbricus terrestris GN=ACT1 PE=2 SV=1 789 1173 3.0E-106
sp|P10995|ACT2_XENLA Actin, alpha skeletal muscle 2 OS=Xenopus laevis GN=act2 PE=2 SV=1 795 1173 4.0E-106
sp|Q93129|ACTC_BRABE Actin, cytoplasmic OS=Branchiostoma belcheri PE=2 SV=1 789 1173 4.0E-106
sp|P07836|ACT1_BOMMO Actin, muscle-type A1 OS=Bombyx mori PE=3 SV=1 795 1173 4.0E-106
sp|P53689|ACT_PHARH Actin OS=Phaffia rhodozyma PE=3 SV=1 789 1173 4.0E-106
sp|Q07903|ACTC_STRPU Actin, cytoskeletal 2A OS=Strongylocentrotus purpuratus GN=CYIIA PE=2 SV=1 789 1173 4.0E-106
sp|Q9NJV4|ACT1_NAEGR Actin-1 OS=Naegleria gruberi GN=ACT1 PE=3 SV=1 795 1173 4.0E-106
sp|P53474|ACTE_STRPU Actin, cytoskeletal 3A OS=Strongylocentrotus purpuratus GN=CYIIIA PE=3 SV=1 789 1173 4.0E-106
sp|P18601|ACT2_ARTSX Actin, clone 211 OS=Artemia sp. PE=2 SV=1 789 1173 4.0E-106
sp|O81221|ACT_GOSHI Actin OS=Gossypium hirsutum PE=3 SV=1 789 1173 4.0E-106
sp|O15998|ACTM_CIOSA Actin, muscle OS=Ciona savignyi PE=2 SV=1 795 1173 4.0E-106
sp|P90689|ACT_BRUMA Actin OS=Brugia malayi PE=1 SV=1 789 1173 4.0E-106
sp|P43239|ACT1_PNECA Actin-1 OS=Pneumocystis carinii PE=2 SV=1 789 1171 5.0E-106
sp|Q9Y702|ACT1_SCHCO Actin-1 OS=Schizophyllum commune GN=ACT1 PE=2 SV=1 789 1173 5.0E-106
sp|Q25472|ACT2_MOLOC Actin, muscle-type OS=Molgula oculata PE=3 SV=1 795 1173 5.0E-106
sp|P68136|ACTS_RAT Actin, alpha skeletal muscle OS=Rattus norvegicus GN=Acta1 PE=1 SV=1 795 1173 5.0E-106
sp|P68135|ACTS_RABIT Actin, alpha skeletal muscle OS=Oryctolagus cuniculus GN=ACTA1 PE=1 SV=1 795 1173 5.0E-106
sp|Q5R9Q5|ACTS_PONAB Actin, alpha skeletal muscle OS=Pongo abelii GN=ACTA1 PE=2 SV=1 795 1173 5.0E-106
sp|P68137|ACTS_PIG Actin, alpha skeletal muscle OS=Sus scrofa GN=ACTA1 PE=3 SV=1 795 1173 5.0E-106
sp|P68134|ACTS_MOUSE Actin, alpha skeletal muscle OS=Mus musculus GN=Acta1 PE=1 SV=1 795 1173 5.0E-106
sp|P68133|ACTS_HUMAN Actin, alpha skeletal muscle OS=Homo sapiens GN=ACTA1 PE=1 SV=1 795 1173 5.0E-106
sp|P68139|ACTS_CHICK Actin, alpha skeletal muscle OS=Gallus gallus GN=ACTA1 PE=1 SV=1 795 1173 5.0E-106
sp|P68138|ACTS_BOVIN Actin, alpha skeletal muscle OS=Bos taurus GN=ACTA1 PE=1 SV=1 795 1173 5.0E-106
sp|Q54GX7|ACT10_DICDI Actin-10 OS=Dictyostelium discoideum GN=act10 PE=1 SV=1 789 1173 6.0E-106
sp|P53479|ACTS_CYPCA Actin, alpha skeletal muscle OS=Cyprinus carpio GN=acta1 PE=2 SV=1 795 1173 6.0E-106
sp|P30171|ACT11_SOLTU Actin-97 OS=Solanum tuberosum GN=AC97 PE=3 SV=1 789 1173 6.0E-106
sp|P07830|ACT1_DICDI Major actin OS=Dictyostelium discoideum GN=act1 PE=1 SV=2 789 1173 6.0E-106
sp|P20904|ACT_VOLCA Actin OS=Volvox carteri PE=3 SV=1 791 1173 6.0E-106
sp|P91754|ACT_LUMRU Actin (Fragment) OS=Lumbricus rubellus PE=2 SV=1 795 1173 7.0E-106
sp|P02574|ACT4_DROME Actin, larval muscle OS=Drosophila melanogaster GN=Act79B PE=1 SV=2 795 1173 7.0E-106
sp|P30173|ACT13_SOLTU Actin-101 OS=Solanum tuberosum GN=AC101 PE=3 SV=1 789 1173 8.0E-106
sp|Q6P640|ACTC_XENTR Actin, alpha cardiac muscle 1 OS=Xenopus tropicalis GN=actc1 PE=2 SV=1 795 1173 1.0E-105
sp|P68035|ACTC_RAT Actin, alpha cardiac muscle 1 OS=Rattus norvegicus GN=Actc1 PE=2 SV=1 795 1173 1.0E-105
sp|P68033|ACTC_MOUSE Actin, alpha cardiac muscle 1 OS=Mus musculus GN=Actc1 PE=1 SV=1 795 1173 1.0E-105
sp|P68032|ACTC_HUMAN Actin, alpha cardiac muscle 1 OS=Homo sapiens GN=ACTC1 PE=1 SV=1 795 1173 1.0E-105
sp|P68034|ACTC_CHICK Actin, alpha cardiac muscle 1 OS=Gallus gallus GN=ACTC1 PE=3 SV=1 795 1173 1.0E-105
sp|Q3ZC07|ACTC_BOVIN Actin, alpha cardiac muscle 1 OS=Bos taurus GN=ACTC1 PE=2 SV=1 795 1173 1.0E-105
sp|P53480|ACTC_TAKRU Actin, alpha cardiac OS=Takifugu rubripes PE=2 SV=1 795 1173 1.0E-105
sp|P46258|ACT3_PEA Actin-3 OS=Pisum sativum PE=2 SV=1 786 1173 1.0E-105
sp|Q90X97|ACTS_ATRMM Actin, alpha skeletal muscle OS=Atractaspis microlepidota microlepidota GN=ACTA1 PE=2 SV=1 795 1173 1.0E-105
sp|P53461|ACTC_HALRO Actin, nonmuscle OS=Halocynthia roretzi GN=CA1 PE=3 SV=1 789 1173 1.0E-105
sp|P27130|ACT2_HALRO Actin, muscle 2/4/4A OS=Halocynthia roretzi GN=MA2 PE=2 SV=1 795 1173 1.0E-105
sp|P50138|ACT_PUCGR Actin OS=Puccinia graminis PE=3 SV=1 787 1173 2.0E-105
sp|P68264|ACTS_OREMO Actin, alpha skeletal muscle OS=Oreochromis mossambicus GN=acta1 PE=2 SV=1 795 1173 2.0E-105
sp|P68140|ACTSA_TAKRU Actin, alpha skeletal muscle A OS=Takifugu rubripes GN=acta1a PE=2 SV=1 795 1173 2.0E-105
sp|P17126|ACT_HYDVU Actin, non-muscle 6.2 OS=Hydra vulgaris PE=3 SV=1 789 1173 2.0E-105
sp|P45887|ACT5_BACDO Actin-5, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 795 1173 2.0E-105
sp|Q98972|ACTS_ORYLA Actin, alpha skeletal muscle OS=Oryzias latipes GN=acta1 PE=2 SV=1 795 1173 2.0E-105
sp|P04752|ACT3_XENLA Actin, alpha skeletal muscle 3 OS=Xenopus laevis GN=act3 PE=2 SV=2 795 1173 3.0E-105
sp|Q9BYX7|ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 795 1173 3.0E-105
sp|P60010|ACT_YEAST Actin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACT1 PE=1 SV=1 791 1171 3.0E-105
sp|P60011|ACT_SACBA Actin OS=Saccharomyces bayanus GN=ACT1 PE=3 SV=1 791 1171 3.0E-105
sp|P60009|ACT_CANGA Actin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACT1 PE=3 SV=1 791 1171 3.0E-105
sp|O17503|ACTC_BRALA Actin, cytoplasmic OS=Branchiostoma lanceolatum PE=2 SV=1 789 1173 3.0E-105
sp|Q8RYC2|ACT5_ARATH Putative actin-5 OS=Arabidopsis thaliana GN=ACT5 PE=5 SV=1 795 1173 3.0E-105
sp|P53496|ACT11_ARATH Actin-11 OS=Arabidopsis thaliana GN=ACT11 PE=1 SV=1 789 1173 3.0E-105
sp|P92176|ACT2_LUMTE Actin-2 OS=Lumbricus terrestris GN=ACT2 PE=2 SV=1 789 1173 4.0E-105
sp|P17128|ACT_KLULA Actin OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACT PE=3 SV=2 791 1171 4.0E-105
sp|P62738|ACTA_RAT Actin, aortic smooth muscle OS=Rattus norvegicus GN=Acta2 PE=2 SV=1 795 1173 4.0E-105
sp|P62740|ACTA_RABIT Actin, aortic smooth muscle OS=Oryctolagus cuniculus GN=ACTA2 PE=2 SV=1 795 1173 4.0E-105
sp|P62737|ACTA_MOUSE Actin, aortic smooth muscle OS=Mus musculus GN=Acta2 PE=1 SV=1 795 1173 4.0E-105
sp|P62736|ACTA_HUMAN Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1 795 1173 4.0E-105
sp|P62739|ACTA_BOVIN Actin, aortic smooth muscle OS=Bos taurus GN=ACTA2 PE=1 SV=1 795 1173 4.0E-105
sp|Q75D00|ACT_ASHGO Actin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACT1 PE=2 SV=1 791 1171 4.0E-105
sp|P63269|ACTH_RAT Actin, gamma-enteric smooth muscle OS=Rattus norvegicus GN=Actg2 PE=2 SV=1 795 1173 4.0E-105
sp|P63268|ACTH_MOUSE Actin, gamma-enteric smooth muscle OS=Mus musculus GN=Actg2 PE=1 SV=1 795 1173 4.0E-105
sp|P63267|ACTH_HUMAN Actin, gamma-enteric smooth muscle OS=Homo sapiens GN=ACTG2 PE=1 SV=1 795 1173 4.0E-105
sp|P63270|ACTH_CHICK Actin, gamma-enteric smooth muscle OS=Gallus gallus GN=ACTG2 PE=1 SV=1 795 1173 4.0E-105
sp|Q5E9B5|ACTH_BOVIN Actin, gamma-enteric smooth muscle OS=Bos taurus GN=ACTG2 PE=2 SV=1 795 1173 4.0E-105
sp|P53494|ACT4_ARATH Actin-4 OS=Arabidopsis thaliana GN=ACT4 PE=1 SV=1 789 1173 5.0E-105
sp|P53482|ACTSB_TAKRU Actin, alpha skeletal muscle B OS=Takifugu rubripes GN=acta1b PE=2 SV=1 795 1173 5.0E-105
sp|P08023|ACTA_CHICK Actin, aortic smooth muscle OS=Gallus gallus GN=ACTA2 PE=1 SV=2 795 1173 6.0E-105
sp|P41113|ACT3_PODCA Actin-3 OS=Podocoryna carnea GN=ACT3 PE=3 SV=1 789 1173 6.0E-105
sp|P07829|ACT3_DICDI Actin-3 OS=Dictyostelium discoideum GN=act3 PE=3 SV=3 789 1173 6.0E-105
sp|Q39758|ACT_FUCVE Actin OS=Fucus vesiculosus PE=2 SV=1 789 1173 7.0E-105
sp|P53465|ACT1_LYTPI Actin, cytoskeletal 1 OS=Lytechinus pictus PE=2 SV=1 789 1173 8.0E-105
sp|Q9UVF3|ACT_YARLI Actin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ACT1 PE=3 SV=2 795 1173 9.0E-105
sp|P53497|ACT12_ARATH Actin-12 OS=Arabidopsis thaliana GN=ACT12 PE=1 SV=1 789 1173 9.0E-105
sp|P02582|ACT1_MAIZE Actin-1 OS=Zea mays GN=ACT1 PE=3 SV=1 789 1171 9.0E-105
sp|P41112|ACT1_PODCA Actin-1/2 OS=Podocoryna carnea GN=ACTIA PE=2 SV=1 789 1173 1.0E-104
sp|Q6P8G3|ACT3_XENTR Actin, alpha sarcomeric/skeletal OS=Xenopus tropicalis GN=act3 PE=2 SV=1 795 1173 1.0E-104
sp|P53475|ACTN_STYCL Actin, muscle OS=Styela clava GN=TB12 PE=2 SV=1 795 1173 1.0E-104
sp|Q9Y701|ACT1_SUIBO Actin-1 OS=Suillus bovinus GN=ACT1 PE=2 SV=1 787 1173 1.0E-104
sp|P30164|ACT1_PEA Actin-1 OS=Pisum sativum PE=2 SV=1 789 1173 1.0E-104
sp|Q10DV7|ACT1_ORYSJ Actin-1 OS=Oryza sativa subsp. japonica GN=ACT1 PE=2 SV=1 789 1173 1.0E-104
sp|A2XLF2|ACT1_ORYSI Actin-1 OS=Oryza sativa subsp. indica GN=ACT1 PE=2 SV=1 789 1173 1.0E-104
sp|Q96292|ACT2_ARATH Actin-2 OS=Arabidopsis thaliana GN=ACT2 PE=1 SV=1 795 1173 1.0E-104
sp|O65316|ACT_MESVI Actin OS=Mesostigma viride PE=3 SV=1 795 1173 2.0E-104
sp|P30165|ACT2_PEA Actin-2 OS=Pisum sativum PE=2 SV=1 789 1173 2.0E-104
sp|Q96293|ACT8_ARATH Actin-8 OS=Arabidopsis thaliana GN=ACT8 PE=1 SV=2 795 1173 2.0E-104
sp|Q9P4D1|ACT_PICPG Actin OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=ACT1 PE=1 SV=1 789 1171 2.0E-104
sp|P26198|ACTM_STYCL Actin, muscle OS=Styela clava PE=2 SV=1 795 1173 3.0E-104
sp|P18499|ACTF_STRPU Actin, cytoskeletal 3B OS=Strongylocentrotus purpuratus GN=CYIIIB PE=2 SV=1 789 1173 4.0E-104
sp|Q8BFZ3|ACTBL_MOUSE Beta-actin-like protein 2 OS=Mus musculus GN=Actbl2 PE=1 SV=1 795 1173 4.0E-104
sp|P53476|ACT_TOXGO Actin OS=Toxoplasma gondii GN=ACT1 PE=3 SV=1 789 1173 7.0E-104
sp|Q9UVZ8|ACT_CANDC Actin OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=ACT1 PE=3 SV=1 789 1171 9.0E-104
sp|P30168|ACT6_SOLTU Actin-71 OS=Solanum tuberosum GN=AC71 PE=3 SV=2 789 1173 1.0E-103
sp|P53466|ACT2_LYTPI Actin, cytoskeletal 2 OS=Lytechinus pictus PE=2 SV=1 789 1173 1.0E-103
sp|P14235|ACT_CANAX Actin OS=Candida albicans GN=ACT1 PE=3 SV=1 789 1171 1.0E-103
sp|P26182|ACT_ACHBI Actin OS=Achlya bisexualis PE=3 SV=1 795 1173 2.0E-103
sp|P22131|ACT1_PHYIN Actin-1 OS=Phytophthora infestans GN=ACTA PE=2 SV=1 795 1173 2.0E-103
sp|O74258|ACT_OGAPD Actin OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=ACT PE=3 SV=2 789 1171 3.0E-103
sp|Q562R1|ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 795 1173 3.0E-103
sp|P86288|ACT2_PLAFX Actin-2 OS=Plasmodium falciparum (isolate HB3) PE=3 SV=1 795 1173 5.0E-103
sp|Q8ILW9|ACT2_PLAF7 Actin-2 OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0124 PE=3 SV=1 795 1173 5.0E-103
sp|Q7RME1|ACT1_PLAYO Actin-1 OS=Plasmodium yoelii yoelii GN=PY02240 PE=3 SV=1 789 1173 5.0E-103
sp|P86287|ACT1_PLAFX Actin-1 OS=Plasmodium falciparum (isolate HB3) PE=1 SV=1 789 1173 1.0E-102
sp|Q8I4X0|ACT1_PLAF7 Actin-1 OS=Plasmodium falciparum (isolate 3D7) GN=PFL2215w PE=3 SV=1 789 1173 1.0E-102
sp|Q9Y896|ACT2_SCHCO Actin-2 OS=Schizophyllum commune GN=ACT2 PE=3 SV=1 795 1173 1.0E-102
sp|P10988|ACT1_PLAFO Actin-1 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 789 1173 2.0E-102
sp|P53500|ACT_CYAME Actin OS=Cyanidioschyzon merolae PE=3 SV=1 789 1173 2.0E-102
sp|P14883|ACT2_PLAFO Actin-2 OS=Plasmodium falciparum (isolate NF54) PE=2 SV=1 795 1173 3.0E-102
sp|Q9UVX4|ACT_COPC7 Actin OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACT1 PE=3 SV=1 787 1173 4.0E-102
sp|P22132|ACT2_PHYIN Actin-2 OS=Phytophthora infestans GN=ACTB PE=2 SV=1 795 1173 6.0E-102
sp|Q7RPB4|ACT2_PLAYO Actin-2 OS=Plasmodium yoelii yoelii GN=PY01545 PE=3 SV=1 787 1173 1.0E-101
sp|P84856|ACTB_CHLPG Actin, cytoplasmic 1 OS=Chlorocebus pygerythrus GN=ACTB PE=1 SV=1 804 1173 1.0E-101
sp|P30172|ACT12_SOLTU Actin-100 (Fragment) OS=Solanum tuberosum GN=AC100 PE=3 SV=1 806 1173 1.0E-101
sp|P53504|ACT1_SORBI Actin-1 OS=Sorghum bicolor GN=AC1 PE=2 SV=1 789 1173 3.0E-101
sp|P07828|ACT18_DICDI Actin-18 OS=Dictyostelium discoideum GN=act18 PE=3 SV=3 789 1173 3.0E-101
sp|P13363|ACT_PHYME Actin OS=Phytophthora megasperma PE=3 SV=1 795 1173 3.0E-101
sp|P12432|ACT1_TRYBB Actin A OS=Trypanosoma brucei brucei PE=3 SV=1 795 1171 4.0E-101
sp|P53502|ACT_FUCDI Actin OS=Fucus distichus PE=2 SV=1 789 1173 5.0E-101
sp|Q00214|ACTM_STYPL Actin, muscle OS=Styela plicata PE=3 SV=1 795 1173 6.0E-101
sp|Q4Z1L3|ACT1_PLABA Actin-1 OS=Plasmodium berghei (strain Anka) GN=PB000323.01.0 PE=1 SV=1 789 1173 4.0E-100
sp|P53499|ACT_CHOCR Actin OS=Chondrus crispus GN=AC PE=2 SV=1 795 1173 6.0E-100
sp|P12431|ACTM_STRPU Actin, muscle OS=Strongylocentrotus purpuratus PE=3 SV=1 789 1163 6.0E-100
sp|Q8SWN8|ACT_ENCCU Actin OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU01_0460 PE=1 SV=2 789 1173 9.0E-100
sp|P12433|ACT2_TRYBB Actin B OS=Trypanosoma brucei brucei PE=3 SV=1 795 1171 5.0E-99
sp|Q93132|ACTM_BRAFL Actin, muscle OS=Branchiostoma floridae PE=2 SV=1 795 1173 6.0E-99
sp|O17502|ACTM_BRALA Actin, muscle OS=Branchiostoma lanceolatum PE=2 SV=1 795 1173 9.0E-99
sp|Q4YU79|ACT2_PLABA Actin-2 OS=Plasmodium berghei (strain Anka) GN=PB001050.02.0 PE=1 SV=1 787 1173 1.0E-98
sp|Q93130|ACTM_BRABE Actin, muscle OS=Branchiostoma belcheri PE=2 SV=1 795 1173 2.0E-98
sp|A5DQP9|ACT_PICGU Actin OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=ACT1 PE=3 SV=1 804 1171 2.0E-98
sp|P18602|ACT3_ARTSX Actin, clone 302 (Fragment) OS=Artemia sp. PE=2 SV=1 839 1173 4.0E-98
sp|P02580|ACT3_SOYBN Actin-3 OS=Glycine max GN=SAC3 PE=3 SV=2 789 1173 5.0E-98
sp|P02581|ACT1_SOYBN Actin-1 OS=Glycine max GN=SAC1 PE=3 SV=2 789 1173 5.0E-98
sp|P53477|ACT_TRYCR Actin OS=Trypanosoma cruzi PE=3 SV=1 795 1171 6.0E-98
sp|P10993|ACT2_TETPY Actin, cytoplasmic OS=Tetrahymena pyriformis PE=3 SV=2 795 1173 1.0E-97
sp|Q99023|ACT_HYPJE Actin OS=Hypocrea jecorina GN=act PE=3 SV=1 787 1171 2.0E-97
sp|Q55EU6|ACT23_DICDI Putative actin-23 OS=Dictyostelium discoideum GN=act23 PE=1 SV=1 804 1173 2.0E-97
sp|P23343|ACT1_DAUCA Actin-1 OS=Daucus carota PE=2 SV=1 789 1173 3.0E-97
sp|P10992|ACT1_TETTH Actin, macronuclear OS=Tetrahymena thermophila PE=1 SV=3 795 1173 4.0E-97
sp|Q96483|ACT2_SOLLC Actin-51 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 806 1149 1.0E-96
sp|P0CG38|POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 795 1173 1.0E-96
sp|P53468|ACT1_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 795 1173 2.0E-96
sp|P24263|ACTD_PHYPO Actin, spherule isoform OS=Physarum polycephalum GN=ARDD PE=2 SV=2 795 1173 2.0E-96
sp|Q96484|ACT3_SOLLC Actin-52 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 806 1149 3.0E-96
sp|P30161|ACT_COSCS Actin (Fragment) OS=Costaria costata PE=3 SV=2 839 1173 3.0E-96
sp|P20360|ACT_EUPCR Actin, cytoplasmic OS=Euplotes crassus PE=3 SV=1 795 1173 5.0E-96
sp|P53491|ACT_ACEPE Actin (Fragment) OS=Acetabularia peniculus PE=3 SV=1 806 1173 6.0E-96
sp|P45521|ACT_PROCL Actin (Fragment) OS=Procambarus clarkii PE=1 SV=1 844 1173 7.0E-96
sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 795 1173 7.0E-96
sp|P93376|ACT6_TOBAC Actin-103 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 7.0E-96
sp|P81228|ACT5_SOLTU Actin-66 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 2.0E-95
sp|P55805|ACT2_STENO Actin, cytoplasmic OS=Sterkiella nova GN=MIC-ACT-1 PE=3 SV=1 795 1173 2.0E-95
sp|Q96482|ACT1_SOLLC Actin-41 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 806 1149 2.0E-95
sp|P81229|ACT8_SOLTU Actin-79 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 3.0E-95
sp|P12715|ACT1_STENO Actin, cytoplasmic OS=Sterkiella nova PE=3 SV=1 795 1173 4.0E-95
sp|P45520|ACT_LEIMA Actin OS=Leishmania major PE=3 SV=1 795 1171 6.0E-95
sp|P93372|ACT4_TOBAC Actin-66 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 7.0E-95
sp|P93371|ACT5_TOBAC Actin-93 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 7.0E-95
sp|P93586|ACT2_SOLTU Actin-46 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 8.0E-95
sp|P93375|ACT7_TOBAC Actin-104 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 9.0E-95
sp|P53483|ACTX_TAKRU Actin, alpha anomalous OS=Takifugu rubripes PE=2 SV=1 795 1171 9.0E-95
sp|A5A3E0|POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 795 1173 1.0E-94
sp|P93584|ACT9_SOLTU Actin-82 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 2.0E-94
sp|P93374|ACT2_TOBAC Actin-53 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 3.0E-94
sp|O00937|ACT_STECV Actin OS=Sterkiella cavicola PE=3 SV=2 795 1173 3.0E-94
sp|P0CG39|POTEJ_HUMAN POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 795 1173 5.0E-94
sp|Q54HF0|ACT25_DICDI Putative actin-25 OS=Dictyostelium discoideum GN=act25 PE=3 SV=1 789 1173 6.0E-94
sp|P93373|ACT3_TOBAC Actin-54 (Fragment) OS=Nicotiana tabacum PE=3 SV=1 806 1149 8.0E-94
sp|Q03342|ACT3_ECHGR Actin-3 (Fragment) OS=Echinococcus granulosus GN=ACTIII PE=2 SV=1 856 1173 2.0E-93
sp|P27132|ACT2_NAEFO Actin-2 (Fragment) OS=Naegleria fowleri PE=2 SV=1 796 1173 3.0E-93
sp|P93587|ACT1_SOLTU Actin-42 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 4.0E-93
sp|Q55CU2|ACT26_DICDI Putative actin-26 OS=Dictyostelium discoideum GN=act26 PE=3 SV=1 787 1173 6.0E-93
sp|P93585|ACT4_SOLTU Actin-65 (Fragment) OS=Solanum tuberosum PE=3 SV=1 806 1149 2.0E-92
sp|P51775|ACT_GIAIN Actin OS=Giardia intestinalis PE=3 SV=1 795 1173 3.0E-92
sp|Q554S6|ACT17_DICDI Actin-17 OS=Dictyostelium discoideum GN=act17 PE=3 SV=1 795 1173 2.0E-91
sp|P30169|ACT7_SOLTU Actin-75 OS=Solanum tuberosum GN=AC75 PE=3 SV=1 795 1173 2.0E-91
sp|P85515|ACTZ_RAT Alpha-centractin OS=Rattus norvegicus GN=Actr1a PE=1 SV=1 795 1173 3.0E-91
sp|P61164|ACTZ_MOUSE Alpha-centractin OS=Mus musculus GN=Actr1a PE=1 SV=1 795 1173 3.0E-91
sp|Q4R6J9|ACTZ_MACFA Alpha-centractin OS=Macaca fascicularis GN=ACTR1A PE=2 SV=1 795 1173 3.0E-91
sp|P61163|ACTZ_HUMAN Alpha-centractin OS=Homo sapiens GN=ACTR1A PE=1 SV=1 795 1173 3.0E-91
sp|P61162|ACTZ_CANLF Alpha-centractin OS=Canis lupus familiaris GN=ACTR1A PE=2 SV=1 795 1173 3.0E-91
sp|Q8R5C5|ACTY_MOUSE Beta-centractin OS=Mus musculus GN=Actr1b PE=1 SV=1 795 1173 4.0E-91
sp|A4IFE3|ACTY_BOVIN Beta-centractin OS=Bos taurus GN=ACTR1B PE=2 SV=1 795 1173 6.0E-91
sp|P42025|ACTY_HUMAN Beta-centractin OS=Homo sapiens GN=ACTR1B PE=1 SV=1 795 1173 8.0E-91
sp|P53469|ACT2_OXYTR Actin, cytoplasmic OS=Oxytricha trifallax PE=3 SV=1 795 1173 3.0E-90
sp|Q96481|ACT4_SOLLC Actin-105 (Fragment) OS=Solanum lycopersicum PE=3 SV=1 806 1149 3.0E-90
sp|P45891|ACTY_DROME Actin-like protein 53D OS=Drosophila melanogaster GN=Arp53D PE=2 SV=2 795 1173 7.0E-90
sp|Q54HF1|ACT24_DICDI Putative actin-24 OS=Dictyostelium discoideum GN=act24 PE=3 SV=1 795 1173 3.0E-89
sp|P45889|ACTZ_DROME Actin-related protein 1 OS=Drosophila melanogaster GN=Arp1 PE=2 SV=2 795 1173 2.0E-88
sp|P93738|ACT9_ARATH Putative actin-9 OS=Arabidopsis thaliana GN=ACT9 PE=5 SV=1 795 1173 3.0E-86
sp|P23344|ACT2_DAUCA Actin-2 OS=Daucus carota PE=2 SV=1 789 1173 7.0E-86
sp|Q54I79|ACTY_DICDI Centractin OS=Dictyostelium discoideum GN=arpA PE=1 SV=1 795 1173 3.0E-85
sp|P38673|ACTZ_NEUCR Actin-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ro-4 PE=3 SV=1 795 1166 7.0E-84
sp|P42023|ACTZ_PNECA Actin-2 OS=Pneumocystis carinii PE=2 SV=1 796 1165 7.0E-84
sp|Q92192|ACT_CALFI Actin (Fragment) OS=Calanus finmarchicus PE=2 SV=1 868 1157 1.0E-82
sp|P02583|ACT2_OXYFA Actin, cytoplasmic OS=Oxytricha fallax PE=3 SV=1 795 1173 1.0E-82
sp|Q8BXF8|ACTT3_MOUSE Actin-related protein T3 OS=Mus musculus GN=Actrt3 PE=1 SV=1 795 1173 2.0E-82
sp|Q92193|ACT_CRAVI Actin (Fragment) OS=Crassostrea virginica PE=2 SV=1 874 1149 2.0E-79
sp|Q2TA43|ACTT2_BOVIN Actin-related protein T2 OS=Bos taurus GN=ACTRT2 PE=2 SV=1 795 1173 2.0E-79
sp|P53503|ACT1_OXYFA Actin, macronuclear OS=Oxytricha fallax PE=3 SV=1 795 1173 5.0E-79
sp|Q9BYD9|ACTT3_HUMAN Actin-related protein T3 OS=Homo sapiens GN=ACTRT3 PE=2 SV=1 795 1173 3.0E-78
sp|Q8TDY3|ACTT2_HUMAN Actin-related protein T2 OS=Homo sapiens GN=ACTRT2 PE=2 SV=2 795 1173 7.0E-76
sp|Q4R317|ACTT2_MACFA Actin-related protein T2 OS=Macaca fascicularis GN=ACTRT2 PE=2 SV=1 795 1173 2.0E-75
sp|Q9D9L5|ACTT2_MOUSE Actin-related protein T2 OS=Mus musculus GN=Actrt2 PE=2 SV=1 795 1173 5.0E-73
sp|Q8TDG2|ACTT1_HUMAN Actin-related protein T1 OS=Homo sapiens GN=ACTRT1 PE=2 SV=2 795 1173 2.0E-71
sp|Q4R821|ACTT1_MACFA Actin-related protein T1 OS=Macaca fascicularis GN=ACTRT1 PE=2 SV=1 795 1173 7.0E-70
sp|Q54HE9|ACT27_DICDI Putative actin-27 OS=Dictyostelium discoideum GN=act27 PE=3 SV=2 795 1172 1.0E-69
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 310 793 1.0E-69
sp|O94630|ARP1_SCHPO Centractin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=arp1 PE=3 SV=1 796 1164 2.0E-69
sp|Q9D9J3|ACTT1_MOUSE Actin-related protein T1 OS=Mus musculus GN=Actrt1 PE=2 SV=1 795 1173 4.0E-69
sp|Q54HE7|ACT28_DICDI Putative actin-28 OS=Dictyostelium discoideum GN=act28 PE=3 SV=1 795 1167 2.0E-68
sp|P38696|ARP1_YEAST Centractin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP1 PE=1 SV=1 795 1174 7.0E-68
sp|Q5XIK1|ACTT1_RAT Actin-related protein T1 OS=Rattus norvegicus GN=Actrt1 PE=2 SV=1 795 1173 1.0E-67
sp|Q54L54|ACT29_DICDI Putative actin-29 OS=Dictyostelium discoideum GN=act29 PE=3 SV=1 795 1173 3.0E-63
sp|P53142|VPS73_YEAST Vacuolar protein sorting-associated protein 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS73 PE=1 SV=1 313 790 9.0E-63
sp|Q4R6Q3|ACL7A_MACFA Actin-like protein 7A OS=Macaca fascicularis GN=ACTL7A PE=2 SV=1 789 1171 6.0E-62
sp|Q641W9|ACL7A_RAT Actin-like protein 7A OS=Rattus norvegicus GN=Actl7a PE=1 SV=1 789 1171 7.0E-62
sp|Q9QY84|ACL7A_MOUSE Actin-like protein 7A OS=Mus musculus GN=Actl7a PE=1 SV=1 789 1171 2.0E-61
sp|Q95JK8|ACL7B_MACFA Actin-like protein 7B OS=Macaca fascicularis GN=ACTL7B PE=2 SV=1 795 1167 3.0E-61
sp|Q9Y614|ACL7B_HUMAN Actin-like protein 7B OS=Homo sapiens GN=ACTL7B PE=2 SV=1 795 1167 5.0E-61
sp|Q9Y615|ACL7A_HUMAN Actin-like protein 7A OS=Homo sapiens GN=ACTL7A PE=1 SV=1 789 1171 5.0E-61
sp|Q4QR76|ACL7B_RAT Actin-like protein 7B OS=Rattus norvegicus GN=Actl7b PE=1 SV=1 795 1167 1.0E-60
sp|Q32L91|ACL7B_BOVIN Actin-like protein 7B OS=Bos taurus GN=ACTL7B PE=2 SV=1 795 1167 1.0E-60
sp|Q32KZ2|ACL7A_BOVIN Actin-like protein 7A OS=Bos taurus GN=ACTL7A PE=2 SV=1 795 1171 2.0E-60
sp|Q2T9W4|ACTL9_BOVIN Actin-like protein 9 OS=Bos taurus GN=ACTL9 PE=2 SV=1 772 1171 1.0E-59
sp|Q9QY83|ACL7B_MOUSE Actin-like protein 7B OS=Mus musculus GN=Actl7b PE=1 SV=2 795 1167 2.0E-59
sp|Q8CG27|ACTL9_MOUSE Actin-like protein 9 OS=Mus musculus GN=Actl9 PE=1 SV=1 774 1171 2.0E-59
sp|Q8TC94|ACTL9_HUMAN Actin-like protein 9 OS=Homo sapiens GN=ACTL9 PE=1 SV=3 782 1171 3.0E-59
sp|Q6AY16|ACTL9_RAT Actin-like protein 9 OS=Rattus norvegicus GN=Actl9 PE=2 SV=1 795 1171 1.0E-58
sp|Q9N4I0|ARP3_CAEEL Actin-related protein 3 OS=Caenorhabditis elegans GN=arx-1 PE=3 SV=1 795 1170 2.0E-58
sp|P78712|ARP3_NEUCR Actin-related protein 3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=arp-3 PE=2 SV=2 795 1174 2.0E-58
sp|Q61WW9|ARP3_CAEBR Actin-related protein 3 OS=Caenorhabditis briggsae GN=arx-1 PE=3 SV=1 795 1170 9.0E-58
sp|Q6K908|ARP3_ORYSJ Actin-related protein 3 OS=Oryza sativa subsp. japonica GN=ARP3 PE=2 SV=1 795 1170 1.0E-55
sp|A2X6S3|ARP3_ORYSI Actin-related protein 3 OS=Oryza sativa subsp. indica GN=ARP3 PE=3 SV=2 795 1170 1.0E-55
sp|P47117|ARP3_YEAST Actin-related protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARP3 PE=1 SV=1 795 1171 2.0E-55
sp|P30170|ACT10_SOLTU Actin-85C (Fragment) OS=Solanum tuberosum GN=AC85C PE=3 SV=1 806 1002 3.0E-55
sp|P32390|ARP3_SCHPO Actin-related protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=act2 PE=1 SV=1 795 1170 5.0E-55
sp|Q9SAF1|ARP3_ARATH Actin-related protein 3 OS=Arabidopsis thaliana GN=ARP3 PE=1 SV=1 795 1170 2.0E-53
sp|P42528|ARP3_DICDI Actin-related protein 3 OS=Dictyostelium discoideum GN=arpC PE=1 SV=1 795 1170 7.0E-53
sp|Q641P0|ARP3B_MOUSE Actin-related protein 3B OS=Mus musculus GN=Actr3b PE=1 SV=1 795 1170 2.0E-52
sp|Q9P1U1|ARP3B_HUMAN Actin-related protein 3B OS=Homo sapiens GN=ACTR3B PE=2 SV=1 795 1170 8.0E-52
sp|Q90WD0|ARP3_CHICK Actin-related protein 3 OS=Gallus gallus GN=ACTR3 PE=2 SV=1 795 1170 2.0E-51
sp|Q5R8R1|ARP3_PONAB Actin-related protein 3 OS=Pongo abelii GN=ACTR3 PE=2 SV=3 795 1170 8.0E-51
sp|P61158|ARP3_HUMAN Actin-related protein 3 OS=Homo sapiens GN=ACTR3 PE=1 SV=3 795 1170 8.0E-51
sp|P61157|ARP3_BOVIN Actin-related protein 3 OS=Bos taurus GN=ACTR3 PE=1 SV=3 795 1170 8.0E-51
sp|Q4V7C7|ARP3_RAT Actin-related protein 3 OS=Rattus norvegicus GN=Actr3 PE=1 SV=1 795 1170 8.0E-51
sp|Q99JY9|ARP3_MOUSE Actin-related protein 3 OS=Mus musculus GN=Actr3 PE=1 SV=3 795 1170 8.0E-51
sp|P32392|ARP3_DROME Actin-related protein 3 OS=Drosophila melanogaster GN=Arp3 PE=2 SV=3 795 1170 2.0E-50
sp|O73723|ARP3_TAKRU Actin-related protein 3 OS=Takifugu rubripes GN=actr3 PE=3 SV=1 795 1170 6.0E-50
sp|D0LWX4|BARP_HALO1 Bacterial actin-related protein OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=barP PE=2 SV=1 795 1174 2.0E-49
sp|P53490|ARP3_ACACA Actin-related protein 3 OS=Acanthamoeba castellanii GN=ARP3 PE=2 SV=1 795 1170 2.0E-49
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 322 802 3.0E-48
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 367 795 6.0E-48
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 312 795 7.0E-48
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 335 802 7.0E-46
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 316 816 4.0E-45
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 329 795 5.0E-45
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 386 797 1.0E-44
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 367 795 1.0E-44
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 386 795 1.0E-44
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 331 793 2.0E-44
sp|Q11212|ACT_SPOLI Actin (Fragment) OS=Spodoptera littoralis PE=2 SV=1 796 962 2.0E-44
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 386 797 2.0E-44
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 405 797 3.0E-44
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 335 811 3.0E-44
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 405 797 3.0E-44
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 405 797 3.0E-44
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 386 795 3.0E-44
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 402 797 5.0E-44
sp|Q3ECP7|ERDL5_ARATH Sugar transporter ERD6-like 5 OS=Arabidopsis thaliana GN=At1g54730 PE=2 SV=2 380 795 6.0E-44
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 386 795 7.0E-44
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 411 797 7.0E-44
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 329 797 7.0E-44
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 402 797 1.0E-43
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 402 797 1.0E-43
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 329 797 1.0E-43
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 335 802 2.0E-43
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 405 797 2.0E-43
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 335 802 3.0E-43
sp|Q9H568|ACTL8_HUMAN Actin-like protein 8 OS=Homo sapiens GN=ACTL8 PE=1 SV=1 795 1166 3.0E-43
sp|Q84M92|ARP4_ARATH Actin-related protein 4 OS=Arabidopsis thaliana GN=ARP4 PE=1 SV=1 789 1176 3.0E-43
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 335 802 5.0E-43
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 329 793 6.0E-43
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 335 793 7.0E-43
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 335 802 7.0E-43
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 387 795 1.0E-42
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 335 793 2.0E-42
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 313 795 3.0E-42
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 335 793 5.0E-42
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 322 793 5.0E-42
sp|A2AKE7|ACL10_MOUSE Actin-like protein 10 OS=Mus musculus GN=Actl10 PE=3 SV=1 857 1168 6.0E-42
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 316 797 8.0E-42
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 402 797 9.0E-42
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 325 835 1.0E-41
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 378 795 1.0E-41
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 364 792 1.0E-41
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 329 797 2.0E-41
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 371 795 3.0E-41
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 405 797 3.0E-41
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 402 797 4.0E-41
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 337 793 5.0E-41
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 364 795 5.0E-41
sp|O04036|ERD6_ARATH Sugar transporter ERD6 OS=Arabidopsis thaliana GN=ERD6 PE=1 SV=3 378 795 5.0E-41
sp|Q25381|ACTM_LYTPI Actin, muscle (Fragment) OS=Lytechinus pictus PE=3 SV=1 993 1173 6.0E-41
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 405 797 1.0E-40
sp|Q6C061|ARP4_YARLI Actin-related protein 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ARP4 PE=3 SV=1 789 1167 1.0E-40
sp|Q25379|ACT3_LYTPI Actin, cytoskeletal 3 (Fragment) OS=Lytechinus pictus PE=3 SV=1 993 1173 1.0E-40
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 364 792 3.0E-40
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 405 797 3.0E-40
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 402 795 3.0E-40
sp|Q8L4Y5|ARP7_ARATH Actin-related protein 7 OS=Arabidopsis thaliana GN=ARP7 PE=1 SV=1 795 1173 4.0E-40
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 329 802 6.0E-40
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 364 797 6.0E-40
sp|A3ANB5|ARP7_ORYSJ Actin-related protein 7 OS=Oryza sativa subsp. japonica GN=ARP7 PE=2 SV=2 795 1173 6.0E-39
sp|A2XMK6|ARP7_ORYSI Actin-related protein 7 OS=Oryza sativa subsp. indica GN=ARP7 PE=2 SV=2 795 1173 6.0E-39
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 331 795 6.0E-39
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 314 795 2.0E-38
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 325 792 4.0E-38
sp|P23586|STP1_ARATH Sugar transport protein 1 OS=Arabidopsis thaliana GN=STP1 PE=1 SV=2 325 799 5.0E-38
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 309 819 5.0E-38
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 325 814 6.0E-38
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 339 795 1.0E-37
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 314 793 2.0E-37
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 367 795 2.0E-37
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 378 795 6.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 385 407 22
2 440 462 22
3 472 494 22
4 501 523 22
5 605 627 22
6 639 661 22
7 671 693 22
8 698 720 22
9 730 752 22
10 765 787 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1374
MKSVGIITLGTCLLAGTTLAIPPQDRSLHRRQYGGYMSRVNTGYKPKAETGYVPRVLNPYGVYEAEREREEADKR
KNGGRVPGSKKEQRPDTPNTSRSTHAPQVPQGNPNPQGLPASQKKQIPQKASASNSSPDVLKAGQMPQRGPDLVA
PAGSQGKSSDACPEGYKPQTISKPGAAQVSDAGNSTSQPQNQGSLERPDPALPSSRGKSADGCPTDKAQNAVGMP
KSPAASEVQVSGATNSEASPTTPQVNGQDSQKHQGSDPGPVSPAGSKDSCPTGYVPQVKPMPDSSGSSAAPNPVS
QENSDVITPPRYQPRQKEPHNSAYFLLIICIVQSGPLQFGFHIAELNAPQDVITCRKKSVPTAIARLSGWLLPPS
QCIPMNEATFAFISSIFTLGALAGALASGPFSSRRGRRLTMRLTAAVYLAGSLVEAVASNAPFMSLGRFLSGLGA
GASTVVVPLYVSETSPPSMSGLFGAMTQISINFGILTTQVLGYFLSHDREWRWILAVGAAISSVQAIGLLLVPES
PVWLAAHGHVTTARQTLQRIRGKSDIDDEVASWGSGNGAEHEGLLPADGAAPSSASQSATKAPVHLGFIQVVKDS
RYRPAIVALVGLMMAQQCCGINAIIMYSVSLFADVFPTSSALLTILISVVNLAMTAASAPLPDRLGRKTCLLISS
VGQGTSALLLAFSIVFGWKLLSAVAVLFFVAFFAVGLGPIPFILASELVDQEAVGAAQSWCLSSNYVATFLVSQF
FLMINTALNESLGGSGWVFFLFAALAAGSTLFVYQAVPETVGKKVLDGGTGFLKVGYAAQNFPEFQFPSIVGRPI
LRSEEKTDNDLVIKDIMCGDDAAAARTMLQISYPMENGIVKKWEDMQHLWDYTFFEKLKVDTQGQKILLTEPPMN
PLKNREQMCEVMFDRYGFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLNHLTKRLDVAGRDVT
RNLIKLLLRRGYALNRTADFETVRQIKEKLCYVSYDLELDKRLSEDTTVLVENYTLPDGRVIRVGSERFEAPECL
FQPHLVDSESPGLGEFLFNTIQSADVDIRASLFKAIVLSGGSSMYPGLPSRLEKELKQLWLTRALQGNPERLNKF
KVRIEDPPRRRHMVFLGGAVLANIMADKESMWVTKAEWEEQGPRVLDKLGPR*
Coding >Ophun1|1374
ATGAAGAGCGTCGGCATCATCACCTTGGGGACTTGTCTCCTCGCCGGCACAACCCTAGCCATACCGCCTCAAGAC
CGCAGTCTTCATCGACGTCAATACGGGGGCTACATGTCGAGAGTCAACACGGGCTACAAGCCGAAAGCCGAAACG
GGCTACGTACCGAGAGTCCTCAATCCTTATGGGGTATATGAAGCAGAACGGGAACGAGAAGAGGCCGATAAGAGA
AAGAATGGAGGACGAGTGCCTGGTTCGAAGAAGGAGCAGCGGCCTGACACTCCGAATACCTCCCGGTCGACGCAT
GCGCCCCAAGTTCCTCAGGGGAACCCGAACCCCCAGGGACTCCCGGCTTCTCAGAAGAAACAGATTCCCCAGAAA
GCCTCGGCTTCTAACTCCAGTCCTGATGTTCTCAAGGCAGGACAGATGCCCCAGCGAGGCCCGGATCTTGTCGCC
CCTGCCGGCTCCCAGGGGAAGTCATCTGATGCTTGTCCTGAGGGCTACAAGCCGCAGACGATTTCGAAGCCTGGC
GCGGCTCAGGTTTCTGACGCGGGGAATTCTACGTCTCAGCCTCAAAACCAGGGTTCCCTCGAACGCCCGGATCCT
GCCCTTCCCAGCTCTCGAGGGAAGTCAGCCGATGGTTGTCCTACCGACAAGGCGCAGAACGCTGTTGGAATGCCA
AAGTCGCCTGCAGCTAGCGAGGTTCAGGTCTCCGGCGCGACAAATTCTGAGGCCAGTCCAACTACGCCTCAGGTT
AACGGTCAGGATTCCCAGAAACACCAAGGTTCTGACCCGGGTCCCGTCTCTCCAGCCGGGTCAAAGGACAGTTGC
CCTACAGGCTACGTGCCGCAGGTGAAGCCGATGCCGGACTCTTCAGGCAGTAGCGCAGCCCCCAACCCCGTCTCT
CAGGAAAATTCAGACGTAATTACTCCTCCGCGCTACCAGCCGAGGCAAAAAGAGCCGCACAATTCTGCCTATTTT
CTACTGATCATCTGCATCGTTCAGTCAGGCCCGCTGCAGTTTGGCTTCCACATCGCCGAACTGAACGCGCCCCAA
GATGTCATCACCTGTCGCAAAAAGTCGGTCCCGACCGCCATCGCCCGACTCTCAGGATGGCTTCTTCCCCCCTCG
CAATGCATTCCGATGAACGAGGCGACTTTTGCCTTCATCTCCTCCATCTTCACCCTCGGTGCCCTCGCCGGCGCG
CTGGCCTCCGGGCCCTTCTCCTCGAGACGCGGCCGCCGGCTCACCATGCGCTTGACCGCAGCCGTGTACCTCGCC
GGCTCGCTGGTCGAGGCGGTCGCCAGCAACGCGCCCTTCATGTCGCTGGGTCGTTTTCTGTCCGGTCTCGGCGCC
GGCGCGTCGACGGTCGTGGTGCCGCTGTACGTTAGCGAGACTTCGCCCCCGTCCATGAGCGGCCTCTTTGGCGCC
ATGACGCAGATTTCCATCAACTTTGGCATCCTCACCACGCAGGTTCTGGGCTATTTTCTGAGCCACGACCGTGAA
TGGCGCTGGATTCTGGCCGTCGGAGCTGCCATCTCCTCCGTTCAAGCCATCGGGTTACTACTTGTGCCAGAGTCT
CCGGTTTGGCTCGCTGCTCATGGACATGTGACTACTGCCAGGCAGACGCTGCAGCGCATCCGCGGCAAGTCCGAC
ATCGACGACGAGGTGGCGTCCTGGGGCTCCGGCAACGGTGCTGAGCACGAGGGTCTACTGCCTGCCGACGGAGCA
GCGCCGTCTTCGGCCTCGCAGTCGGCGACCAAGGCACCCGTTCATCTCGGCTTCATTCAAGTGGTCAAGGATAGC
CGCTATCGGCCCGCCATCGTCGCGCTGGTCGGGTTGATGATGGCTCAGCAATGTTGCGGCATCAACGCCATCATC
ATGTACTCCGTCTCGCTCTTCGCCGACGTGTTTCCCACGTCATCGGCTCTCCTGACTATCCTAATCTCGGTGGTC
AATCTCGCCATGACGGCTGCCAGCGCGCCGCTGCCCGACCGTCTAGGCCGCAAGACCTGTCTTCTCATATCAAGT
GTCGGCCAGGGCACCAGCGCGTTGCTGCTCGCCTTTTCGATTGTGTTTGGGTGGAAGCTTCTGTCGGCCGTTGCC
GTCTTGTTCTTCGTCGCCTTCTTCGCGGTCGGGCTCGGCCCTATACCGTTCATCCTCGCGTCGGAACTGGTCGAC
CAGGAAGCTGTCGGAGCGGCGCAGAGCTGGTGTCTCTCTTCCAACTACGTGGCTACCTTTCTCGTTTCTCAGTTC
TTCCTGATGATCAACACGGCGCTGAACGAGTCTCTGGGAGGCTCGGGATGGGTCTTCTTTCTGTTTGCCGCGCTG
GCCGCTGGGTCGACCTTGTTCGTGTACCAAGCCGTGCCCGAAACTGTTGGGAAGAAGGTTCTCGATGGCGGCACC
GGCTTCCTCAAGGTCGGCTACGCGGCGCAGAACTTTCCCGAATTTCAGTTCCCGTCCATCGTCGGGCGACCGATC
CTCCGGTCCGAAGAGAAGACGGACAATGATCTGGTCATCAAGGACATCATGTGCGGTGACGACGCCGCCGCTGCC
CGGACGATGCTGCAGATCAGCTACCCCATGGAGAACGGCATCGTCAAGAAGTGGGAAGACATGCAGCATCTCTGG
GACTACACCTTTTTCGAGAAGCTCAAGGTGGACACGCAAGGACAAAAGATTCTCCTGACGGAGCCGCCCATGAAT
CCGCTCAAGAATCGGGAGCAGATGTGCGAGGTCATGTTTGACAGATATGGATTCGGCGGTGTTTACGTCGCCATC
CAGGCGGTCCTGGCCCTATACGCGCAGGGCTTAAGCTCCGGCGTCGTGGTGGACTCTGGAGACGGCGTGACGCAC
ATCGTGCCCGTGTACGAGTCCGTCGTGCTCAATCATCTCACCAAGCGGCTGGACGTGGCGGGCCGTGACGTAACG
CGCAACCTGATCAAGCTCCTCCTACGCCGGGGCTACGCGCTGAACCGCACGGCCGACTTCGAGACGGTGCGGCAG
ATCAAGGAGAAGCTGTGCTACGTCTCGTACGACCTCGAGCTGGACAAGCGGCTGAGCGAGGACACGACGGTGCTG
GTGGAAAACTACACGCTACCGGACGGGCGGGTAATACGGGTCGGCAGCGAGCGTTTCGAGGCGCCCGAGTGCCTG
TTCCAGCCGCACCTCGTCGACAGCGAGTCGCCGGGGCTGGGCGAGTTCCTGTTCAACACGATCCAGTCGGCCGAC
GTGGACATCCGGGCGTCGCTGTTCAAGGCCATTGTGCTGTCGGGCGGCAGCAGCATGTACCCAGGGTTGCCGTCG
CGACTGGAGAAGGAGCTGAAGCAACTGTGGCTGACGCGGGCGCTCCAGGGCAACCCGGAGCGGCTCAACAAGTTC
AAAGTACGGATCGAGGACCCTCCGCGGAGGAGACACATGGTATTTCTGGGGGGCGCGGTGCTGGCCAACATCATG
GCGGACAAGGAGAGCATGTGGGTGACAAAGGCCGAGTGGGAGGAGCAGGGGCCGCGGGTGCTGGACAAGTTGGGG
CCGCGATGA
Transcript >Ophun1|1374
ATGAAGAGCGTCGGCATCATCACCTTGGGGACTTGTCTCCTCGCCGGCACAACCCTAGCCATACCGCCTCAAGAC
CGCAGTCTTCATCGACGTCAATACGGGGGCTACATGTCGAGAGTCAACACGGGCTACAAGCCGAAAGCCGAAACG
GGCTACGTACCGAGAGTCCTCAATCCTTATGGGGTATATGAAGCAGAACGGGAACGAGAAGAGGCCGATAAGAGA
AAGAATGGAGGACGAGTGCCTGGTTCGAAGAAGGAGCAGCGGCCTGACACTCCGAATACCTCCCGGTCGACGCAT
GCGCCCCAAGTTCCTCAGGGGAACCCGAACCCCCAGGGACTCCCGGCTTCTCAGAAGAAACAGATTCCCCAGAAA
GCCTCGGCTTCTAACTCCAGTCCTGATGTTCTCAAGGCAGGACAGATGCCCCAGCGAGGCCCGGATCTTGTCGCC
CCTGCCGGCTCCCAGGGGAAGTCATCTGATGCTTGTCCTGAGGGCTACAAGCCGCAGACGATTTCGAAGCCTGGC
GCGGCTCAGGTTTCTGACGCGGGGAATTCTACGTCTCAGCCTCAAAACCAGGGTTCCCTCGAACGCCCGGATCCT
GCCCTTCCCAGCTCTCGAGGGAAGTCAGCCGATGGTTGTCCTACCGACAAGGCGCAGAACGCTGTTGGAATGCCA
AAGTCGCCTGCAGCTAGCGAGGTTCAGGTCTCCGGCGCGACAAATTCTGAGGCCAGTCCAACTACGCCTCAGGTT
AACGGTCAGGATTCCCAGAAACACCAAGGTTCTGACCCGGGTCCCGTCTCTCCAGCCGGGTCAAAGGACAGTTGC
CCTACAGGCTACGTGCCGCAGGTGAAGCCGATGCCGGACTCTTCAGGCAGTAGCGCAGCCCCCAACCCCGTCTCT
CAGGAAAATTCAGACGTAATTACTCCTCCGCGCTACCAGCCGAGGCAAAAAGAGCCGCACAATTCTGCCTATTTT
CTACTGATCATCTGCATCGTTCAGTCAGGCCCGCTGCAGTTTGGCTTCCACATCGCCGAACTGAACGCGCCCCAA
GATGTCATCACCTGTCGCAAAAAGTCGGTCCCGACCGCCATCGCCCGACTCTCAGGATGGCTTCTTCCCCCCTCG
CAATGCATTCCGATGAACGAGGCGACTTTTGCCTTCATCTCCTCCATCTTCACCCTCGGTGCCCTCGCCGGCGCG
CTGGCCTCCGGGCCCTTCTCCTCGAGACGCGGCCGCCGGCTCACCATGCGCTTGACCGCAGCCGTGTACCTCGCC
GGCTCGCTGGTCGAGGCGGTCGCCAGCAACGCGCCCTTCATGTCGCTGGGTCGTTTTCTGTCCGGTCTCGGCGCC
GGCGCGTCGACGGTCGTGGTGCCGCTGTACGTTAGCGAGACTTCGCCCCCGTCCATGAGCGGCCTCTTTGGCGCC
ATGACGCAGATTTCCATCAACTTTGGCATCCTCACCACGCAGGTTCTGGGCTATTTTCTGAGCCACGACCGTGAA
TGGCGCTGGATTCTGGCCGTCGGAGCTGCCATCTCCTCCGTTCAAGCCATCGGGTTACTACTTGTGCCAGAGTCT
CCGGTTTGGCTCGCTGCTCATGGACATGTGACTACTGCCAGGCAGACGCTGCAGCGCATCCGCGGCAAGTCCGAC
ATCGACGACGAGGTGGCGTCCTGGGGCTCCGGCAACGGTGCTGAGCACGAGGGTCTACTGCCTGCCGACGGAGCA
GCGCCGTCTTCGGCCTCGCAGTCGGCGACCAAGGCACCCGTTCATCTCGGCTTCATTCAAGTGGTCAAGGATAGC
CGCTATCGGCCCGCCATCGTCGCGCTGGTCGGGTTGATGATGGCTCAGCAATGTTGCGGCATCAACGCCATCATC
ATGTACTCCGTCTCGCTCTTCGCCGACGTGTTTCCCACGTCATCGGCTCTCCTGACTATCCTAATCTCGGTGGTC
AATCTCGCCATGACGGCTGCCAGCGCGCCGCTGCCCGACCGTCTAGGCCGCAAGACCTGTCTTCTCATATCAAGT
GTCGGCCAGGGCACCAGCGCGTTGCTGCTCGCCTTTTCGATTGTGTTTGGGTGGAAGCTTCTGTCGGCCGTTGCC
GTCTTGTTCTTCGTCGCCTTCTTCGCGGTCGGGCTCGGCCCTATACCGTTCATCCTCGCGTCGGAACTGGTCGAC
CAGGAAGCTGTCGGAGCGGCGCAGAGCTGGTGTCTCTCTTCCAACTACGTGGCTACCTTTCTCGTTTCTCAGTTC
TTCCTGATGATCAACACGGCGCTGAACGAGTCTCTGGGAGGCTCGGGATGGGTCTTCTTTCTGTTTGCCGCGCTG
GCCGCTGGGTCGACCTTGTTCGTGTACCAAGCCGTGCCCGAAACTGTTGGGAAGAAGGTTCTCGATGGCGGCACC
GGCTTCCTCAAGGTCGGCTACGCGGCGCAGAACTTTCCCGAATTTCAGTTCCCGTCCATCGTCGGGCGACCGATC
CTCCGGTCCGAAGAGAAGACGGACAATGATCTGGTCATCAAGGACATCATGTGCGGTGACGACGCCGCCGCTGCC
CGGACGATGCTGCAGATCAGCTACCCCATGGAGAACGGCATCGTCAAGAAGTGGGAAGACATGCAGCATCTCTGG
GACTACACCTTTTTCGAGAAGCTCAAGGTGGACACGCAAGGACAAAAGATTCTCCTGACGGAGCCGCCCATGAAT
CCGCTCAAGAATCGGGAGCAGATGTGCGAGGTCATGTTTGACAGATATGGATTCGGCGGTGTTTACGTCGCCATC
CAGGCGGTCCTGGCCCTATACGCGCAGGGCTTAAGCTCCGGCGTCGTGGTGGACTCTGGAGACGGCGTGACGCAC
ATCGTGCCCGTGTACGAGTCCGTCGTGCTCAATCATCTCACCAAGCGGCTGGACGTGGCGGGCCGTGACGTAACG
CGCAACCTGATCAAGCTCCTCCTACGCCGGGGCTACGCGCTGAACCGCACGGCCGACTTCGAGACGGTGCGGCAG
ATCAAGGAGAAGCTGTGCTACGTCTCGTACGACCTCGAGCTGGACAAGCGGCTGAGCGAGGACACGACGGTGCTG
GTGGAAAACTACACGCTACCGGACGGGCGGGTAATACGGGTCGGCAGCGAGCGTTTCGAGGCGCCCGAGTGCCTG
TTCCAGCCGCACCTCGTCGACAGCGAGTCGCCGGGGCTGGGCGAGTTCCTGTTCAACACGATCCAGTCGGCCGAC
GTGGACATCCGGGCGTCGCTGTTCAAGGCCATTGTGCTGTCGGGCGGCAGCAGCATGTACCCAGGGTTGCCGTCG
CGACTGGAGAAGGAGCTGAAGCAACTGTGGCTGACGCGGGCGCTCCAGGGCAACCCGGAGCGGCTCAACAAGTTC
AAAGTACGGATCGAGGACCCTCCGCGGAGGAGACACATGGTATTTCTGGGGGGCGCGGTGCTGGCCAACATCATG
GCGGACAAGGAGAGCATGTGGGTGACAAAGGCCGAGTGGGAGGAGCAGGGGCCGCGGGTGCTGGACAAGTTGGGG
CCGCGATGA
Gene >Ophun1|1374
ATGAAGAGCGTCGGCATCATCACCTTGGGGACTTGTCTCCTCGCCGGCACAACCCTAGCCATACCGCCTCAAGAC
CGCAGTCTTCATCGACGTCAATGTATGTGTCCACCACGATAATCTCAAGGCTGGCCGTCCGAGATCTAATTTTCC
CTTTTGCATGTTAGACGGGGGCTACATGTCGAGAGTCAACACGGGCTACAAGCCGAAAGCCGAAACGGGCTACGT
ACCGAGAGTCCTCAATCCTTATGGGGTATATGAAGCAGAACGGGAACGAGAAGAGGCCGATAAGAGAAAGAATGG
AGGACGAGTGCCTGGTTCGAAGAAGGAGCAGCGGCCTGACACTCCGAATACCTCCCGGTCGACGCATGCGCCCCA
AGTTCCTCAGGGGAACCCGAACCCCCAGGGACTCCCGGCTTCTCAGAAGAAACAGATTCCCCAGAAAGCCTCGGC
TTCTAACTCCAGTCCTGATGTTCTCAAGGCAGGACAGATGCCCCAGCGAGGCCCGGATCTTGTCGCCCCTGCCGG
CTCCCAGGGGAAGTCATCTGATGCTTGTCCTGAGGGCTACAAGCCGCAGACGATTTCGAAGCCTGGCGCGGCTCA
GGTTTCTGACGCGGGGAATTCTACGTCTCAGCCTCAAAACCAGGGTTCCCTCGAACGCCCGGATCCTGCCCTTCC
CAGCTCTCGAGGGAAGTCAGCCGATGGTTGTCCTACCGACAAGGCGCAGAACGCTGTTGGAATGCCAAAGTCGCC
TGCAGCTAGCGAGGTTCAGGTCTCCGGCGCGACAAATTCTGAGGCCAGTCCAACTACGCCTCAGGTTAACGGTCA
GGATTCCCAGAAACACCAAGGTTCTGACCCGGGTCCCGTCTCTCCAGCCGGGTCAAAGGACAGTTGCCCTACAGG
CTACGTGCCGCAGGTGAAGCCGATGCCGGACTCTTCAGGCAGTAGCGCAGCCCCCAACCCCGTCTCTCAGGAAAA
TTCAGACGTAATTACTCCTCCGCGCTACCAGCCGAGGCAAAAAGAGCCGCACAATTCTGGTAAAAGCCAGCAGTC
GAAAGCAGATGTCGCTTCTCCGACCCAAACTGGTGTAAGCCAGGGGCCGAAAGTAGATGGTGTTTCCTCCAGGAC
GCGGCTGAATGGGAAGAAGAAGCCTCGATGGCCGATGAATAAGTTCGAGTTACCTAAACCAGTGGAGGGGTGATG
GAGCGAAAACCACTCCCTGAGGTATGTGTTTATAGATTGCTTGACGGGGTCAAGCCGGGTGGCTGATTGTTTGGG
ATGTTTCTCGATTTCTTGGTGTTCCGTTGCCTGCAGATTAGTATGTCAGTGTCAGGTTCATATTAGCTCTTTGTA
CGCATATGAATCGAAAAGGGCAACGATAGCTTCGACGCGCTGCTCCCCCTTGACGAGGACAAAATCATCAAAGGT
CGTCGTTGAGTCTTCACACAGCCTACCTACCCTAGGGACTAAACCTTAGGACGATTTAGGTCCGGATTATCCAGA
TGGTCCGGCGCAATCCATCCATCCACCTTCATCTTCACCAGACCTTCTCTTGGCGTCATGGCTGGCCGCGGGCTT
CGCAGCATCACAGCCTATTTTCTACTGATCATCTGCATCGTTCAGTCAGGCCCGCTGCAGTTTGGCTTCCACATC
GTGAGTTCAGGTCCGCGCCATCACCTTCCGTCGCTAACCCGGGCGTCTCCCTTCAGGCCGAACTGAACGCGCCCC
AAGATGTCATCACCTGTCGCAAAAAGTCGGTCCCGACCGCCATCGCCCGACTCTCAGGATGGCTTCTTCCCCCCT
CGCAATGCATTCCGATGAACGAGGCGACTTTTGCCTTCATCTCCTCCATCTTCACCCTCGGTGCCCTCGCCGGCG
CGCTGGCCTCCGGGCCCTTCTCCTCGAGACGCGGCCGCCGGCTCACCATGCGCTTGACCGCAGCCGTGTACCTCG
CCGGCTCGCTGGTCGAGGCGGTCGCCAGCAACGCGCCCTTCATGTCGCTGGGTCGTTTTCTGTCCGGTCTCGGCG
CCGGCGCGTCGACGGTCGTGGTGCCGCTGTACGTTAGCGAGACTTCGCCCCCGTCCATGAGCGGCCTCTTTGGCG
CCATGACGCAGATTTCCATCAACTTTGGCATCCTCACCACGCAGGTTCTGGGCTATTTTCTGAGCCACGACCGTG
AATGGCGCTGGATTCTGGCCGTCGGAGCTGCCATCTCCTCCGTTCAAGCCATCGGGTTACTACTTGTGCCAGAGT
CTCCGGTTTGGCTCGCTGCTCATGGACATGTGACTACTGCCAGGCAGACGCTGCAGCGCATCCGCGGCAAGTCCG
ACATCGACGACGAGGTGGCGTCCTGGGGCTCCGGCAACGGTGCTGAGCACGAGGGTCTACTGCCTGCCGACGGAG
CAGCGCCGTCTTCGGCCTCGCAGTCGGCGACCAAGGCACCCGTTCATCTCGGCTTCATTCAAGTGGTCAAGGATA
GCCGCTATCGGCCCGCCATCGTCGCGCTGGTCGGGTTGATGATGGCTCAGCAATGTTGCGGCATCAACGCCATCA
TCATGTACTCCGTCTCGCTCTTCGCCGACGTGTTTCCCACGTCATCGGCTCTCCTGACTATCCTAATCTCGGTGG
TCAATCTCGCCATGACGGCTGCCAGCGCGCCGCTGCCCGACCGTCTAGGCCGCAAGACCTGTCTTCTCATATCAA
GTGTCGGCCAGGGCACCAGCGCGTTGCTGCTCGCCTTTTCGATTGTGTTTGGGTGGAAGCTTCTGTCGGCCGTTG
CCGTCTTGTTCTTCGTCGCCTTCTTCGCGGTCGGGCTCGGCCCTATACCGTTCATCCTCGCGTCGGAACTGGTCG
ACCAGGAAGCTGTCGGAGCGGCGCAGAGCTGGTGTCTCTCTTCCAACTACGTGGCTACCTTTCTCGTTTCTCAGT
TCTTCCTGATGATCAACACGGCGCTGAACGAGTCTCTGGGAGGCTCGGGATGGGTCTTCTTTCTGTTTGCCGCGC
TGGCCGCTGGGTCGACCTTGTTCGTGTACCAAGCCGTGCCCGAAACTGTTGGGAAGAAGGGTATGCAGGAGGTCT
GGGGAAGCTATCGACGGCTGGATTAGGACTGCAGTCGACATGTGTGACTATAGAAGAATGCCAGCTTTCGCGTCG
TGAAATCGACCTGACGACTTGACCGACGCTCGTCCTGCACGTGCCATCGGCCTCATCGGCGCACGTGACCCCCCC
GCCAAGTGCCTTACCAAAGGCCTCTGACGACAACTCGACCCACAAGCTCAAGCTCCCTTGACACACTCGGAACAA
GCAAGCCGTCGCCATCCTCGGCTTCATCATCGCCGCCTCTCCTACTTGCGACTCCAGCGAAGATGGGAATCCCTC
CACCTATCGGTACGTTTCCGCGAGCGCCGACAGCTGCACCCGTTCTCCCTTCCCGTCCCGCTGGCGGCTGACTCG
GCTCCAGTTCTCGATGGCGGCACCGGCTTCCTCAAGGTCGGCTACGCGGCGCAGAACTTTCCCGAATTTCAGTTC
CCGTCCATCGTCGGGCGACCGATCCTCCGGTCCGAAGAGAAGACGGACAATGATCTGGTCATCAAGGACATCATG
TGCGGTGACGACGCCGCCGCTGCCCGGACGATGCTGCAGATCAGCTACCCCATGGAGAACGGCATCGTCAAGAAG
TGGGAAGACATGCAGCATCTCTGGGACTACACCTTTTTCGAGAAGCTCAAGGTGGACACGCAAGGACAAAAGATT
CTCCTGACGGAGCCGCCCATGAATCCGCTCAAGAATCGGGAGCAGATGTGCGAGGTCATGTTTGACAGATATGGA
TTCGGCGGTGTTTACGTCGCCATCCAGGCGGTCCTGGCCCTATACGCGCAGGGTGAGTCGGCCCTCCTGGCATCT
CGGACATTGGTTCACACGCACGGTCAGGCTTAAGCTCCGGCGTCGTGGTGGACTCTGGAGACGGCGTGACGCACA
TCGTGCCCGTGTACGAGTCCGTCGTGCTCAATCATCTCACCAAGCGGCTGGACGTGGCGGGCCGTGACGTAACGC
GCAACCTGATCAAGCTCCTCCTACGCCGGGGCTACGCGCTGAACCGCACGGCCGACTTCGAGACGGTGCGGCAGA
TCAAGGAGAAGCTGTGCTACGTCTCGTACGACCTCGAGCTGGACAAGCGGCTGAGCGAGGACACGACGGTGCTGG
TGGAAAACTACACGCTACCGGACGGGCGGGTAATACGGGTCGGCAGCGAGCGTTTCGAGGCGCCCGAGTGCCTGT
TCCAGCCGCACCTCGTCGACAGCGAGTCGCCGGGGCTGGGCGAGTTCCTGTTCAACACGATCCAGTCGGCCGACG
TGGACATCCGGGCGTCGCTGTTCAAGGCCATTGTGCTGTCGGGCGGCAGCAGCATGTACCCAGGGTTGCCGTCGC
GACTGGAGAAGGAGCTGAAGCAACTGTGGCTGACGCGGGCGCTCCAGGGCAACCCGGAGCGGCTCAACAAGTTCA
AAGTACGGATCGAGGACCCTCCGCGGAGGAGACACATGGTATTTCTGGGGGGCGCGGTGCTGGCCAACATCATGG
CGGACAAGGAGAGCATGTGGGTGACAAAGGCCGAGTGGGAGGAGCAGGGGCCGCGGGTGCTGGACAAGTTGGGGC
CGCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail