Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1372
Gene name
LocationContig_1549:349..856
Strand-
Gene length (bp)507
Transcript length (bp)507
Coding sequence length (bp)507
Protein length (aa) 169

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00410 Ribosomal_S8 Ribosomal protein S8 5.7E-08 7 167

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03799|RT08_YEAST 37S ribosomal protein S8, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRPS8 PE=1 SV=1 3 167 9.0E-25
sp|O74956|RT08_SCHPO 37S ribosomal protein subunit S8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrps8 PE=3 SV=1 12 167 8.0E-23
sp|A2SLE3|RS8_METPP 30S ribosomal protein S8 OS=Methylibium petroleiphilum (strain PM1) GN=rpsH PE=3 SV=1 7 168 6.0E-07
sp|Q5FTZ7|RS8_GLUOX 30S ribosomal protein S8 OS=Gluconobacter oxydans (strain 621H) GN=rpsH PE=3 SV=1 7 167 8.0E-07
sp|A9H3M1|RS8_GLUDA 30S ribosomal protein S8 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpsH PE=3 SV=1 7 167 1.0E-06

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:0043043 peptide biosynthetic process No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:0043170 macromolecule metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0005198 structural molecule activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0006807 nitrogen compound metabolic process No
GO:0110165 cellular anatomical entity No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0009059 macromolecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0043603 cellular amide metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7499
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|1372 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1535

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1372
MPSIINIANMCSHLQNATKARLGITSVKNTKYNLQLALAMHRSGLISAIYRGKAKPPTLEEMVAKPPEIVTEANV
AAMRLWLGLKYLEGRPIFSKAEVVTTPKRPISATIPQLGQISQGFDTATKKGRGVVRGLNLGELLFLTTCCGVLE
SREALSRKVGGLLLCRVS*
Coding >Ophun1|1372
ATGCCATCCATCATCAACATAGCCAACATGTGCTCCCATTTACAAAATGCTACCAAGGCTCGTCTTGGGATTACG
TCGGTGAAAAACACCAAATACAACCTACAACTGGCCTTGGCCATGCACCGGTCTGGTCTTATTTCCGCGATTTAC
CGTGGCAAGGCCAAGCCGCCAACCCTGGAGGAGATGGTCGCCAAACCGCCTGAGATTGTGACCGAAGCAAATGTG
GCGGCAATGAGACTATGGCTGGGGTTGAAGTATCTTGAGGGCCGACCTATCTTTTCGAAGGCAGAAGTCGTTACC
ACTCCCAAACGACCTATCTCAGCTACCATTCCGCAACTTGGCCAGATTTCGCAGGGATTTGATACTGCCACGAAA
AAGGGGCGTGGAGTAGTGCGAGGGCTTAATCTTGGTGAATTACTATTTCTTACTACATGCTGCGGAGTTCTAGAG
AGCAGAGAGGCTTTGTCACGGAAAGTAGGAGGGCTTCTGTTGTGCCGAGTATCATAG
Transcript >Ophun1|1372
ATGCCATCCATCATCAACATAGCCAACATGTGCTCCCATTTACAAAATGCTACCAAGGCTCGTCTTGGGATTACG
TCGGTGAAAAACACCAAATACAACCTACAACTGGCCTTGGCCATGCACCGGTCTGGTCTTATTTCCGCGATTTAC
CGTGGCAAGGCCAAGCCGCCAACCCTGGAGGAGATGGTCGCCAAACCGCCTGAGATTGTGACCGAAGCAAATGTG
GCGGCAATGAGACTATGGCTGGGGTTGAAGTATCTTGAGGGCCGACCTATCTTTTCGAAGGCAGAAGTCGTTACC
ACTCCCAAACGACCTATCTCAGCTACCATTCCGCAACTTGGCCAGATTTCGCAGGGATTTGATACTGCCACGAAA
AAGGGGCGTGGAGTAGTGCGAGGGCTTAATCTTGGTGAATTACTATTTCTTACTACATGCTGCGGAGTTCTAGAG
AGCAGAGAGGCTTTGTCACGGAAAGTAGGAGGGCTTCTGTTGTGCCGAGTATCATAG
Gene >Ophun1|1372
ATGCCATCCATCATCAACATAGCCAACATGTGCTCCCATTTACAAAATGCTACCAAGGCTCGTCTTGGGATTACG
TCGGTGAAAAACACCAAATACAACCTACAACTGGCCTTGGCCATGCACCGGTCTGGTCTTATTTCCGCGATTTAC
CGTGGCAAGGCCAAGCCGCCAACCCTGGAGGAGATGGTCGCCAAACCGCCTGAGATTGTGACCGAAGCAAATGTG
GCGGCAATGAGACTATGGCTGGGGTTGAAGTATCTTGAGGGCCGACCTATCTTTTCGAAGGCAGAAGTCGTTACC
ACTCCCAAACGACCTATCTCAGCTACCATTCCGCAACTTGGCCAGATTTCGCAGGGATTTGATACTGCCACGAAA
AAGGGGCGTGGAGTAGTGCGAGGGCTTAATCTTGGTGAATTACTATTTCTTACTACATGCTGCGGAGTTCTAGAG
AGCAGAGAGGCTTTGTCACGGAAAGTAGGAGGGCTTCTGTTGTGCCGAGTATCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail