Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1369
Gene name
LocationContig_1547:444..1471
Strand-
Gene length (bp)1027
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13087 AAA_12 AAA domain 4.4E-19 117 324

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VGT4|ZGRF1_MOUSE Protein ZGRF1 OS=Mus musculus GN=Zgrf1 PE=1 SV=2 62 326 9.0E-11
sp|Q86YA3|ZGRF1_HUMAN Protein ZGRF1 OS=Homo sapiens GN=ZGRF1 PE=2 SV=3 62 326 8.0E-10
sp|Q9FJR0|RENT1_ARATH Regulator of nonsense transcripts 1 homolog OS=Arabidopsis thaliana GN=UPF1 PE=1 SV=2 23 324 3.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.5

Transmembrane Domains

Domain # Start End Length
1 31 53 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1369
MFRTEVSEYANSPANFDGDRLGKLKVMGQKLLGEVLSFAAVIIATPVALGQAATRLNFDTDLVIVDEAARMSEAQ
ALISKAHFDNAVHIFLGDPRQFCPVSQLAASQHPNVWSRQRQRSILHRAVQNGQVDGNLRLSYRCRGRIAEWAAN
SVYGSSMEIVHQQDELTEAMRTFLGGLTSPSAESPITFRANCAWLAFSGSSDQSFGTSFGNTMQARFVVQVAKQA
FLEGPVIDVNKWEPGQPLDQAQMGTVLILCGYAQQKALYERLVEEIPPSQIPPGRLSVRTIDDSQSHQATVVILD
LVRTGKCGFLDDQARLVVATTRAQGH*
Coding >Ophun1|1369
ATGTTCCGGACCGAGGTCAGCGAATACGCCAACAGCCCTGCGAATTTTGATGGCGACCGGCTTGGCAAGCTGAAA
GTAATGGGCCAAAAGCTTCTCGGTGAAGTGTTATCCTTTGCGGCGGTAATCATTGCCACCCCGGTAGCGCTAGGA
CAAGCCGCCACCAGACTCAATTTCGACACGGACCTGGTCATCGTGGATGAGGCAGCCCGGATGTCTGAAGCACAA
GCCCTCATTTCCAAGGCTCACTTCGACAATGCTGTCCACATCTTCCTGGGGGACCCTCGCCAATTTTGCCCTGTA
TCGCAACTCGCCGCATCGCAACATCCCAACGTCTGGTCTAGACAGCGACAACGCAGCATCCTTCACCGCGCCGTA
CAGAACGGACAGGTAGATGGTAACCTTCGCCTTAGCTATCGTTGCCGCGGCAGGATTGCCGAATGGGCAGCAAAT
TCGGTTTACGGGAGCTCAATGGAGATAGTCCACCAACAGGATGAGCTGACGGAGGCTATGCGAACATTTCTCGGC
GGCCTCACTTCGCCGTCTGCAGAAAGTCCGATCACTTTCCGCGCGAATTGCGCCTGGCTTGCGTTTTCAGGGTCG
TCCGACCAATCATTTGGCACATCCTTTGGCAATACCATGCAAGCTCGTTTTGTCGTCCAAGTTGCAAAACAAGCA
TTCTTGGAGGGTCCTGTTATCGACGTCAACAAGTGGGAGCCCGGGCAGCCGCTGGACCAGGCACAAATGGGCACC
GTCCTCATACTCTGCGGCTACGCTCAGCAGAAGGCGCTGTATGAGCGACTTGTCGAAGAGATCCCTCCCTCGCAG
ATTCCTCCCGGCCGTCTCTCAGTTCGGACTATCGACGACTCTCAGAGTCACCAGGCTACCGTTGTGATCCTGGAC
CTCGTCAGGACTGGGAAATGTGGCTTTCTCGACGACCAAGCCCGTCTTGTGGTGGCCACGACACGCGCCCAAGGC
CATTGA
Transcript >Ophun1|1369
ATGTTCCGGACCGAGGTCAGCGAATACGCCAACAGCCCTGCGAATTTTGATGGCGACCGGCTTGGCAAGCTGAAA
GTAATGGGCCAAAAGCTTCTCGGTGAAGTGTTATCCTTTGCGGCGGTAATCATTGCCACCCCGGTAGCGCTAGGA
CAAGCCGCCACCAGACTCAATTTCGACACGGACCTGGTCATCGTGGATGAGGCAGCCCGGATGTCTGAAGCACAA
GCCCTCATTTCCAAGGCTCACTTCGACAATGCTGTCCACATCTTCCTGGGGGACCCTCGCCAATTTTGCCCTGTA
TCGCAACTCGCCGCATCGCAACATCCCAACGTCTGGTCTAGACAGCGACAACGCAGCATCCTTCACCGCGCCGTA
CAGAACGGACAGGTAGATGGTAACCTTCGCCTTAGCTATCGTTGCCGCGGCAGGATTGCCGAATGGGCAGCAAAT
TCGGTTTACGGGAGCTCAATGGAGATAGTCCACCAACAGGATGAGCTGACGGAGGCTATGCGAACATTTCTCGGC
GGCCTCACTTCGCCGTCTGCAGAAAGTCCGATCACTTTCCGCGCGAATTGCGCCTGGCTTGCGTTTTCAGGGTCG
TCCGACCAATCATTTGGCACATCCTTTGGCAATACCATGCAAGCTCGTTTTGTCGTCCAAGTTGCAAAACAAGCA
TTCTTGGAGGGTCCTGTTATCGACGTCAACAAGTGGGAGCCCGGGCAGCCGCTGGACCAGGCACAAATGGGCACC
GTCCTCATACTCTGCGGCTACGCTCAGCAGAAGGCGCTGTATGAGCGACTTGTCGAAGAGATCCCTCCCTCGCAG
ATTCCTCCCGGCCGTCTCTCAGTTCGGACTATCGACGACTCTCAGAGTCACCAGGCTACCGTTGTGATCCTGGAC
CTCGTCAGGACTGGGAAATGTGGCTTTCTCGACGACCAAGCCCGTCTTGTGGTGGCCACGACACGCGCCCAAGGC
CATTGA
Gene >Ophun1|1369
ATGTTCCGGACCGAGGTCAGCGAATACGCCAACAGCCCTGCGAATTTTGATGGCGACCGGCTTGGCAAGCTGAAA
GTAATGGGCCAAAAGCTTCTCGGTGAAGTGTTATCCTTTGCGGCGGTAATCATTGCCACCCCGGTAGCGCTAGGA
CAAGCCGCCACCAGACTCAATTTCGACACGGACCTGGTCATCGTGGATGAGGCAGCCCGGATGTCTGAAGCACAA
GCCCTCATTTCCAAGGCTCACTTCGACAATGCTGTCCACATCTTCCTGGGGGACCCTCGCCAATTTTGCCCTGTA
TCGCAACTCGCCGCATCGCAACATCCCAACGTCTGGTCTAGACAGCGACAACGCAGCATCCTTCACCGCGCCGTA
CAGAACGGACAGGTAGATGGTAACCTTCGCCTTAGCTATCGTTGCCGCGGCAGGATTGCCGAATGGGCAGCAAAT
TCGGTTTACGGGAGCTCAATGGAGATAGTCCACCAACAGGATGAGCTGACGGAGGCTATGCGAACATTTCTCGGC
GGCCTCACTTCGCCGTCTGCAGAAAGTCCGATCACTTTCCGCGCGAATTGCGCCTGGCTTGCGTTTTCAGGGTCG
TCCGACCAATCATTTGGCACATCCTTTGGCAATACCATGCAAGCTCGTTTTGTCGTCCAAGTTGCAAAACAAGCA
TTCTTGGAGGGTCCTGTTATCGACGTCAACAAGTGGGAGCCCGGGCAGCCGCTGGACCAGGCACAAATGGGCACC
GTCCTCATACTCTGCGGCTACGCTCAGCAGAAGGCGCTGTATGAGCGACTTGTCGAAGAGATCCCTCCCTCGCAG
ATTCCTCCCGGCCGTCTCTCAGTTCGGACTATCGACGACTCTCAGAGTCACCAGGCTACCGTTGTGATCCTGGAC
CTCGTCAGGACTGGGAAATGTGGCTTTCTCGACGACCAAGCCCGTCTTGTGGTGGCCACGACACGCGCCCAAGTC
GGGCTCATTATCGTTGGGGATGCTGATATAGTCCCATCGAAAGGGCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail