Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1368
Gene name
LocationContig_1546:514..1519
Strand-
Gene length (bp)1005
Transcript length (bp)1005
Coding sequence length (bp)1005
Protein length (aa) 335

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10021 DUF2263 Uncharacterized protein conserved in bacteria (DUF2263) 1.0E-08 79 157

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1701
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1879
Ophiocordyceps australis map64 (Brazil) OphauB2|7627
Ophiocordyceps camponoti-floridani Ophcf2|00561
Ophiocordyceps camponoti-rufipedis Ophun1|1368 (this protein)
Ophiocordyceps kimflemingae Ophio5|1089
Ophiocordyceps subramaniannii Hirsu2|1493

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1368
MAPASRSGRVRPAEVAAETKRNFIPLINAHHAHEFPPYSVLYRQPAAQLAIRRRVPSTRPPVFRFVAGDPVMAAE
SYGASDSRSSERRVRIPFICAANEKRPGGDWETGCSGYEEKLCRRSNLSATLSTPDPATGERSNYPIPTSGGILS
DSVVVWRGPHDRYDQLDDWYDLPIVSVPPIRWPKLRDNGTRYSFSTERDMMRDKMRGALRICLYHGYDRVVIGDF
GLGNSCRNPPRELAEIWRDVFLFDPDMRGQFVYVVFAFEDADQSTVRMILDEIAKRNRNGAHPRPEPSTAPGPPP
PTDMAIFQLVFADSEIERVLSAPDPRYDLNMITS*
Coding >Ophun1|1368
ATGGCACCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAACGCGCACCACGCACACGAGTTCCCTCCCTACTCGGTGTTATACCGGCAGCCGGCGGCGCAGTTGGCG
ATCCGGAGACGGGTGCCCAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGAGACCCCGTCATGGCGGCCGAG
TCGTACGGCGCATCCGACAGCCGGAGCAGCGAACGACGGGTCCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGGAGCAACCTATCGGCC
ACGCTCAGCACGCCGGACCCAGCCACGGGAGAGAGATCCAACTACCCAATCCCGACATCGGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGCCCCCACGATCGTTACGACCAGCTAGATGACTGGTACGATCTGCCCATCGTG
TCCGTACCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGCACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGATAAGATGCGCGGAGCCCTCCGCATCTGCCTCTACCACGGCTACGACCGCGTCGTCATCGGCGACTTT
GGCCTCGGAAACAGCTGCCGCAACCCTCCCCGGGAACTGGCCGAGATCTGGCGAGACGTCTTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGACCAGAGCACCGTCCGCATGATCCTC
GACGAGATTGCCAAGAGGAACCGCAACGGCGCCCACCCCCGGCCCGAACCCTCCACCGCTCCTGGACCCCCTCCT
CCGACAGACATGGCCATCTTCCAGCTCGTCTTTGCCGATTCGGAGATCGAACGCGTCCTCAGCGCCCCTGACCCG
CGCTACGACCTCAACATGATCACCTCCTGA
Transcript >Ophun1|1368
ATGGCACCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAACGCGCACCACGCACACGAGTTCCCTCCCTACTCGGTGTTATACCGGCAGCCGGCGGCGCAGTTGGCG
ATCCGGAGACGGGTGCCCAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGAGACCCCGTCATGGCGGCCGAG
TCGTACGGCGCATCCGACAGCCGGAGCAGCGAACGACGGGTCCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGGAGCAACCTATCGGCC
ACGCTCAGCACGCCGGACCCAGCCACGGGAGAGAGATCCAACTACCCAATCCCGACATCGGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGCCCCCACGATCGTTACGACCAGCTAGATGACTGGTACGATCTGCCCATCGTG
TCCGTACCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGCACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGATAAGATGCGCGGAGCCCTCCGCATCTGCCTCTACCACGGCTACGACCGCGTCGTCATCGGCGACTTT
GGCCTCGGAAACAGCTGCCGCAACCCTCCCCGGGAACTGGCCGAGATCTGGCGAGACGTCTTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGACCAGAGCACCGTCCGCATGATCCTC
GACGAGATTGCCAAGAGGAACCGCAACGGCGCCCACCCCCGGCCCGAACCCTCCACCGCTCCTGGACCCCCTCCT
CCGACAGACATGGCCATCTTCCAGCTCGTCTTTGCCGATTCGGAGATCGAACGCGTCCTCAGCGCCCCTGACCCG
CGCTACGACCTCAACATGATCACCTCCTGA
Gene >Ophun1|1368
ATGGCACCGGCTTCCAGGTCCGGCAGGGTCAGGCCAGCCGAGGTGGCGGCCGAGACCAAGAGAAACTTCATACCG
CTCATCAACGCGCACCACGCACACGAGTTCCCTCCCTACTCGGTGTTATACCGGCAGCCGGCGGCGCAGTTGGCG
ATCCGGAGACGGGTGCCCAGCACGCGGCCTCCCGTCTTCCGCTTCGTGGCCGGAGACCCCGTCATGGCGGCCGAG
TCGTACGGCGCATCCGACAGCCGGAGCAGCGAACGACGGGTCCGGATCCCCTTCATCTGCGCCGCCAACGAGAAG
CGGCCCGGAGGCGACTGGGAGACGGGCTGCTCGGGCTACGAAGAGAAGCTCTGCCGGCGGAGCAACCTATCGGCC
ACGCTCAGCACGCCGGACCCAGCCACGGGAGAGAGATCCAACTACCCAATCCCGACATCGGGCGGCATCCTGTCC
GACTCGGTCGTCGTCTGGCGCGGCCCCCACGATCGTTACGACCAGCTAGATGACTGGTACGATCTGCCCATCGTG
TCCGTACCTCCGATCCGGTGGCCCAAACTCAGGGACAATGGCACCAGATATTCCTTCTCTACGGAACGCGACATG
ATGCGCGATAAGATGCGCGGAGCCCTCCGCATCTGCCTCTACCACGGCTACGACCGCGTCGTCATCGGCGACTTT
GGCCTCGGAAACAGCTGCCGCAACCCTCCCCGGGAACTGGCCGAGATCTGGCGAGACGTCTTCCTCTTCGACCCA
GATATGCGCGGCCAGTTCGTCTACGTCGTCTTCGCCTTCGAGGACGCCGACCAGAGCACCGTCCGCATGATCCTC
GACGAGATTGCCAAGAGGAACCGCAACGGCGCCCACCCCCGGCCCGAACCCTCCACCGCTCCTGGACCCCCTCCT
CCGACAGACATGGCCATCTTCCAGCTCGTCTTTGCCGATTCGGAGATCGAACGCGTCCTCAGCGCCCCTGACCCG
CGCTACGACCTCAACATGATCACCTCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail