Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1359
Gene name
LocationContig_154:15143..17411
Strand-
Gene length (bp)2268
Transcript length (bp)2268
Coding sequence length (bp)2268
Protein length (aa) 756

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06046 Sec6 Exocyst complex component Sec6 2.4E-160 176 754

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74846|SEC6_SCHPO Exocyst complex component sec6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec6 PE=1 SV=2 2 735 2.0E-73
sp|P32844|SEC6_YEAST Exocyst complex component SEC6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC6 PE=1 SV=2 1 741 7.0E-44
sp|Q94AI6|SEC6_ARATH Exocyst complex component SEC6 OS=Arabidopsis thaliana GN=SEC6 PE=1 SV=1 3 665 5.0E-21
sp|O60645|EXOC3_HUMAN Exocyst complex component 3 OS=Homo sapiens GN=EXOC3 PE=1 SV=2 6 740 9.0E-19
sp|Q6KAR6|EXOC3_MOUSE Exocyst complex component 3 OS=Mus musculus GN=Exoc3 PE=1 SV=2 6 740 7.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74846|SEC6_SCHPO Exocyst complex component sec6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec6 PE=1 SV=2 2 735 2.0E-73
sp|P32844|SEC6_YEAST Exocyst complex component SEC6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC6 PE=1 SV=2 1 741 7.0E-44
sp|Q94AI6|SEC6_ARATH Exocyst complex component SEC6 OS=Arabidopsis thaliana GN=SEC6 PE=1 SV=1 3 665 5.0E-21
sp|O60645|EXOC3_HUMAN Exocyst complex component 3 OS=Homo sapiens GN=EXOC3 PE=1 SV=2 6 740 9.0E-19
sp|Q6KAR6|EXOC3_MOUSE Exocyst complex component 3 OS=Mus musculus GN=Exoc3 PE=1 SV=2 6 740 7.0E-18
sp|Q62825|EXOC3_RAT Exocyst complex component 3 OS=Rattus norvegicus GN=Exoc3 PE=1 SV=1 6 740 1.0E-17
sp|Q19262|EXOC3_CAEEL Exocyst complex component 3 OS=Caenorhabditis elegans GN=sec-6 PE=3 SV=2 1 670 3.0E-14
sp|Q0V8C2|EXOC3_BOVIN Exocyst complex component 3 OS=Bos taurus GN=EXOC3 PE=2 SV=1 6 735 4.0E-14
sp|Q9V8K2|EXOC3_DROME Exocyst complex component 3 OS=Drosophila melanogaster GN=Sec6 PE=2 SV=2 9 673 3.0E-11
sp|Q54BP6|EXOC3_DICDI Exocyst complex component 3 OS=Dictyostelium discoideum GN=exoc3 PE=3 SV=1 4 741 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006887 exocytosis Yes
GO:0000145 exocyst Yes
GO:0051179 localization No
GO:0016192 vesicle-mediated transport No
GO:0099023 vesicle tethering complex No
GO:0140352 export from cell No
GO:0051234 establishment of localization No
GO:0009987 cellular process No
GO:0046903 secretion No
GO:0006810 transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0032940 secretion by cell No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2715
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|648
Ophiocordyceps australis map64 (Brazil) OphauB2|5970
Ophiocordyceps camponoti-floridani Ophcf2|05699
Ophiocordyceps camponoti-rufipedis Ophun1|1359 (this protein)
Ophiocordyceps kimflemingae Ophio5|5896
Ophiocordyceps subramaniannii Hirsu2|4249

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1359
MDDGPVPKLADLLRHPEDLDKIPALKLEFSRKKGAVDGRLRTGLREQLDTTQAGMTGLGDGQKTVQLIKDEMIKI
DRLCSESQTMIRDFASINLVSQAHRNFGAVEAMRRNLESFNERLVVVEDMLRQDDEDKENMPNLLPCHYELTLLR
NMRDDAMEQAERVDDAGLVATLEDYFGRLDETIDWFDEHVGILAMNLISLVVNDNNGLVVRFAVVMEAEERSDRR
VLALQEALRDHQDMASRFRGITDGPKKARGYKQKFIEAIRISAEQQLEQAREEFLDDASNLDKAMKWFFNDLNAV
KMGMTPLMPKRWRVAKTYADVYHGLMHDLLVGMVDDGSTSSAHMLEIAGFPEKYYKKMAKLGFGPNELQPHVLDK
REAELVDGFRQLIVKFLDEWIDRILAQEKKDLAERGTAEGSNLDQDEYGYFRTKNLVALWRMLREQVDAGANSQR
ADVVEGVVDAMFLRLRGRQQAWQRMLEDEATAFETGDAASVVVEGSFQALQDWLVATANDQIACVDDNEDEGRLG
YLSSFRQKLEPVVSTAYLERADDEVAALRDGYLDLSTWCLNRFAQLIFAVDFRSVMPEIFTAKWYSSSAMKQMVA
TFDEYISDYRQVLHHSLVDIFVEVLADELLVRYLSSVRNRAVKFRRADPFRDRLFADVASAFDFFDDALPDVAPQ
VKQTWRVTEPFLRLVDCPREQVADAFADFKTAYWDLNIGWVEAVLRARDDFDRALLNGVLARAAQVEVVRGAETI
MGRVK*
Coding >Ophun1|1359
ATGGACGATGGCCCCGTGCCAAAGCTCGCGGACCTGCTCCGGCACCCAGAAGACCTCGACAAGATCCCCGCGCTC
AAGCTCGAATTCTCGCGCAAAAAGGGCGCCGTCGATGGTCGGCTGCGCACCGGGCTGCGGGAGCAACTCGACACG
ACGCAGGCGGGCATGACGGGCCTAGGGGACGGGCAGAAGACGGTGCAGCTGATCAAGGACGAGATGATCAAGATT
GACCGGCTGTGCTCCGAGTCGCAGACCATGATCCGCGACTTTGCTAGCATCAACCTCGTTTCGCAGGCGCATCGC
AACTTTGGCGCTGTCGAGGCCATGAGGCGGAATCTCGAGTCGTTCAATGAGCGGTTGGTGGTGGTGGAGGATATG
CTGAGGCAGGACGACGAGGACAAGGAGAACATGCCGAATTTGCTGCCGTGTCACTACGAGCTGACGCTTCTGCGG
AACATGCGCGACGATGCTATGGAGCAGGCCGAGCGGGTCGATGACGCGGGGCTGGTGGCGACGCTGGAAGACTAC
TTTGGCCGGTTGGACGAGACGATCGACTGGTTCGACGAGCATGTGGGCATCCTGGCCATGAATCTCATCAGCCTG
GTGGTCAACGATAACAACGGGCTCGTCGTCCGCTTCGCAGTCGTCATGGAGGCCGAGGAGCGCAGCGACAGACGG
GTGCTGGCGCTGCAGGAGGCGCTACGGGATCACCAAGACATGGCGTCTCGCTTCCGCGGCATCACCGACGGGCCC
AAGAAGGCGCGCGGCTATAAGCAAAAGTTCATCGAGGCGATACGCATCAGCGCGGAGCAGCAGCTGGAGCAGGCG
CGCGAAGAGTTTCTCGACGACGCTTCGAACCTCGACAAGGCCATGAAGTGGTTCTTTAACGATCTCAATGCCGTC
AAGATGGGCATGACGCCCTTGATGCCGAAGCGGTGGAGGGTGGCCAAGACGTACGCCGACGTCTACCACGGTCTG
ATGCACGACCTGCTGGTGGGCATGGTGGACGACGGGTCGACGAGCTCGGCGCACATGCTGGAGATTGCGGGCTTC
CCGGAAAAGTACTACAAGAAGATGGCCAAGCTGGGGTTCGGACCGAACGAGCTGCAGCCGCACGTGCTGGACAAG
CGCGAGGCTGAGCTGGTCGACGGCTTCCGGCAGCTGATTGTCAAGTTCCTGGACGAATGGATCGACCGGATCCTG
GCGCAGGAGAAGAAGGACCTTGCGGAGCGAGGGACGGCCGAGGGCTCCAACCTGGACCAGGACGAGTACGGATAC
TTCCGGACTAAGAATCTGGTTGCCCTGTGGCGGATGCTGCGCGAGCAGGTCGACGCGGGGGCCAACTCGCAGCGA
GCCGACGTGGTCGAAGGCGTCGTCGACGCCATGTTTCTTCGTCTCCGAGGCCGACAGCAGGCGTGGCAGAGGATG
CTCGAGGACGAAGCGACGGCCTTTGAAACGGGGGATGCAGCCTCGGTCGTCGTCGAGGGGAGCTTCCAGGCGCTG
CAGGACTGGCTCGTAGCGACGGCCAACGACCAGATCGCCTGCGTCGATGACAACGAGGACGAGGGTCGGCTGGGA
TACCTCTCGAGCTTCCGACAGAAGCTCGAGCCCGTCGTGTCGACGGCCTACCTCGAACGAGCCGACGACGAAGTC
GCCGCCCTGCGAGACGGCTATCTCGATCTCAGCACCTGGTGTCTCAACCGCTTCGCCCAGCTCATCTTCGCCGTC
GACTTCCGCTCCGTCATGCCGGAAATCTTCACGGCCAAGTGGTACAGCTCGTCGGCCATGAAGCAGATGGTGGCC
ACCTTTGACGAATACATCTCCGACTACCGCCAAGTCCTCCACCACTCCCTCGTCGACATCTTCGTCGAGGTCCTC
GCAGACGAGCTGCTGGTGCGCTACCTCTCCAGCGTGCGCAACCGAGCCGTCAAGTTCCGCCGCGCCGACCCCTTC
CGCGATAGGCTCTTCGCCGACGTCGCCTCGGCCTTTGACTTCTTCGACGACGCCCTCCCCGACGTGGCGCCCCAG
GTGAAGCAGACGTGGCGCGTCACGGAGCCGTTCCTGCGGCTGGTCGACTGTCCGCGCGAGCAAGTGGCCGACGCG
TTTGCGGATTTCAAGACGGCGTACTGGGATTTGAACATCGGCTGGGTCGAGGCTGTGCTGCGGGCGAGAGATGAT
TTCGATAGGGCGCTTTTGAATGGTGTGTTGGCGAGGGCGGCGCAGGTGGAGGTTGTGAGGGGGGCGGAGACGATT
ATGGGGAGGGTGAAGTGA
Transcript >Ophun1|1359
ATGGACGATGGCCCCGTGCCAAAGCTCGCGGACCTGCTCCGGCACCCAGAAGACCTCGACAAGATCCCCGCGCTC
AAGCTCGAATTCTCGCGCAAAAAGGGCGCCGTCGATGGTCGGCTGCGCACCGGGCTGCGGGAGCAACTCGACACG
ACGCAGGCGGGCATGACGGGCCTAGGGGACGGGCAGAAGACGGTGCAGCTGATCAAGGACGAGATGATCAAGATT
GACCGGCTGTGCTCCGAGTCGCAGACCATGATCCGCGACTTTGCTAGCATCAACCTCGTTTCGCAGGCGCATCGC
AACTTTGGCGCTGTCGAGGCCATGAGGCGGAATCTCGAGTCGTTCAATGAGCGGTTGGTGGTGGTGGAGGATATG
CTGAGGCAGGACGACGAGGACAAGGAGAACATGCCGAATTTGCTGCCGTGTCACTACGAGCTGACGCTTCTGCGG
AACATGCGCGACGATGCTATGGAGCAGGCCGAGCGGGTCGATGACGCGGGGCTGGTGGCGACGCTGGAAGACTAC
TTTGGCCGGTTGGACGAGACGATCGACTGGTTCGACGAGCATGTGGGCATCCTGGCCATGAATCTCATCAGCCTG
GTGGTCAACGATAACAACGGGCTCGTCGTCCGCTTCGCAGTCGTCATGGAGGCCGAGGAGCGCAGCGACAGACGG
GTGCTGGCGCTGCAGGAGGCGCTACGGGATCACCAAGACATGGCGTCTCGCTTCCGCGGCATCACCGACGGGCCC
AAGAAGGCGCGCGGCTATAAGCAAAAGTTCATCGAGGCGATACGCATCAGCGCGGAGCAGCAGCTGGAGCAGGCG
CGCGAAGAGTTTCTCGACGACGCTTCGAACCTCGACAAGGCCATGAAGTGGTTCTTTAACGATCTCAATGCCGTC
AAGATGGGCATGACGCCCTTGATGCCGAAGCGGTGGAGGGTGGCCAAGACGTACGCCGACGTCTACCACGGTCTG
ATGCACGACCTGCTGGTGGGCATGGTGGACGACGGGTCGACGAGCTCGGCGCACATGCTGGAGATTGCGGGCTTC
CCGGAAAAGTACTACAAGAAGATGGCCAAGCTGGGGTTCGGACCGAACGAGCTGCAGCCGCACGTGCTGGACAAG
CGCGAGGCTGAGCTGGTCGACGGCTTCCGGCAGCTGATTGTCAAGTTCCTGGACGAATGGATCGACCGGATCCTG
GCGCAGGAGAAGAAGGACCTTGCGGAGCGAGGGACGGCCGAGGGCTCCAACCTGGACCAGGACGAGTACGGATAC
TTCCGGACTAAGAATCTGGTTGCCCTGTGGCGGATGCTGCGCGAGCAGGTCGACGCGGGGGCCAACTCGCAGCGA
GCCGACGTGGTCGAAGGCGTCGTCGACGCCATGTTTCTTCGTCTCCGAGGCCGACAGCAGGCGTGGCAGAGGATG
CTCGAGGACGAAGCGACGGCCTTTGAAACGGGGGATGCAGCCTCGGTCGTCGTCGAGGGGAGCTTCCAGGCGCTG
CAGGACTGGCTCGTAGCGACGGCCAACGACCAGATCGCCTGCGTCGATGACAACGAGGACGAGGGTCGGCTGGGA
TACCTCTCGAGCTTCCGACAGAAGCTCGAGCCCGTCGTGTCGACGGCCTACCTCGAACGAGCCGACGACGAAGTC
GCCGCCCTGCGAGACGGCTATCTCGATCTCAGCACCTGGTGTCTCAACCGCTTCGCCCAGCTCATCTTCGCCGTC
GACTTCCGCTCCGTCATGCCGGAAATCTTCACGGCCAAGTGGTACAGCTCGTCGGCCATGAAGCAGATGGTGGCC
ACCTTTGACGAATACATCTCCGACTACCGCCAAGTCCTCCACCACTCCCTCGTCGACATCTTCGTCGAGGTCCTC
GCAGACGAGCTGCTGGTGCGCTACCTCTCCAGCGTGCGCAACCGAGCCGTCAAGTTCCGCCGCGCCGACCCCTTC
CGCGATAGGCTCTTCGCCGACGTCGCCTCGGCCTTTGACTTCTTCGACGACGCCCTCCCCGACGTGGCGCCCCAG
GTGAAGCAGACGTGGCGCGTCACGGAGCCGTTCCTGCGGCTGGTCGACTGTCCGCGCGAGCAAGTGGCCGACGCG
TTTGCGGATTTCAAGACGGCGTACTGGGATTTGAACATCGGCTGGGTCGAGGCTGTGCTGCGGGCGAGAGATGAT
TTCGATAGGGCGCTTTTGAATGGTGTGTTGGCGAGGGCGGCGCAGGTGGAGGTTGTGAGGGGGGCGGAGACGATT
ATGGGGAGGGTGAAGTGA
Gene >Ophun1|1359
ATGGACGATGGCCCCGTGCCAAAGCTCGCGGACCTGCTCCGGCACCCAGAAGACCTCGACAAGATCCCCGCGCTC
AAGCTCGAATTCTCGCGCAAAAAGGGCGCCGTCGATGGTCGGCTGCGCACCGGGCTGCGGGAGCAACTCGACACG
ACGCAGGCGGGCATGACGGGCCTAGGGGACGGGCAGAAGACGGTGCAGCTGATCAAGGACGAGATGATCAAGATT
GACCGGCTGTGCTCCGAGTCGCAGACCATGATCCGCGACTTTGCTAGCATCAACCTCGTTTCGCAGGCGCATCGC
AACTTTGGCGCTGTCGAGGCCATGAGGCGGAATCTCGAGTCGTTCAATGAGCGGTTGGTGGTGGTGGAGGATATG
CTGAGGCAGGACGACGAGGACAAGGAGAACATGCCGAATTTGCTGCCGTGTCACTACGAGCTGACGCTTCTGCGG
AACATGCGCGACGATGCTATGGAGCAGGCCGAGCGGGTCGATGACGCGGGGCTGGTGGCGACGCTGGAAGACTAC
TTTGGCCGGTTGGACGAGACGATCGACTGGTTCGACGAGCATGTGGGCATCCTGGCCATGAATCTCATCAGCCTG
GTGGTCAACGATAACAACGGGCTCGTCGTCCGCTTCGCAGTCGTCATGGAGGCCGAGGAGCGCAGCGACAGACGG
GTGCTGGCGCTGCAGGAGGCGCTACGGGATCACCAAGACATGGCGTCTCGCTTCCGCGGCATCACCGACGGGCCC
AAGAAGGCGCGCGGCTATAAGCAAAAGTTCATCGAGGCGATACGCATCAGCGCGGAGCAGCAGCTGGAGCAGGCG
CGCGAAGAGTTTCTCGACGACGCTTCGAACCTCGACAAGGCCATGAAGTGGTTCTTTAACGATCTCAATGCCGTC
AAGATGGGCATGACGCCCTTGATGCCGAAGCGGTGGAGGGTGGCCAAGACGTACGCCGACGTCTACCACGGTCTG
ATGCACGACCTGCTGGTGGGCATGGTGGACGACGGGTCGACGAGCTCGGCGCACATGCTGGAGATTGCGGGCTTC
CCGGAAAAGTACTACAAGAAGATGGCCAAGCTGGGGTTCGGACCGAACGAGCTGCAGCCGCACGTGCTGGACAAG
CGCGAGGCTGAGCTGGTCGACGGCTTCCGGCAGCTGATTGTCAAGTTCCTGGACGAATGGATCGACCGGATCCTG
GCGCAGGAGAAGAAGGACCTTGCGGAGCGAGGGACGGCCGAGGGCTCCAACCTGGACCAGGACGAGTACGGATAC
TTCCGGACTAAGAATCTGGTTGCCCTGTGGCGGATGCTGCGCGAGCAGGTCGACGCGGGGGCCAACTCGCAGCGA
GCCGACGTGGTCGAAGGCGTCGTCGACGCCATGTTTCTTCGTCTCCGAGGCCGACAGCAGGCGTGGCAGAGGATG
CTCGAGGACGAAGCGACGGCCTTTGAAACGGGGGATGCAGCCTCGGTCGTCGTCGAGGGGAGCTTCCAGGCGCTG
CAGGACTGGCTCGTAGCGACGGCCAACGACCAGATCGCCTGCGTCGATGACAACGAGGACGAGGGTCGGCTGGGA
TACCTCTCGAGCTTCCGACAGAAGCTCGAGCCCGTCGTGTCGACGGCCTACCTCGAACGAGCCGACGACGAAGTC
GCCGCCCTGCGAGACGGCTATCTCGATCTCAGCACCTGGTGTCTCAACCGCTTCGCCCAGCTCATCTTCGCCGTC
GACTTCCGCTCCGTCATGCCGGAAATCTTCACGGCCAAGTGGTACAGCTCGTCGGCCATGAAGCAGATGGTGGCC
ACCTTTGACGAATACATCTCCGACTACCGCCAAGTCCTCCACCACTCCCTCGTCGACATCTTCGTCGAGGTCCTC
GCAGACGAGCTGCTGGTGCGCTACCTCTCCAGCGTGCGCAACCGAGCCGTCAAGTTCCGCCGCGCCGACCCCTTC
CGCGATAGGCTCTTCGCCGACGTCGCCTCGGCCTTTGACTTCTTCGACGACGCCCTCCCCGACGTGGCGCCCCAG
GTGAAGCAGACGTGGCGCGTCACGGAGCCGTTCCTGCGGCTGGTCGACTGTCCGCGCGAGCAAGTGGCCGACGCG
TTTGCGGATTTCAAGACGGCGTACTGGGATTTGAACATCGGCTGGGTCGAGGCTGTGCTGCGGGCGAGAGATGAT
TTCGATAGGGCGCTTTTGAATGGTGTGTTGGCGAGGGCGGCGCAGGTGGAGGTTGTGAGGGGGGCGGAGACGATT
ATGGGGAGGGTGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail