Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1357
Gene name
LocationContig_154:9101..10580
Strand-
Gene length (bp)1479
Transcript length (bp)1407
Coding sequence length (bp)1407
Protein length (aa) 469

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 1.1E-60 9 333
PF02852 Pyr_redox_dim Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain 1.7E-32 355 466
PF00070 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 9.9E-20 179 255
PF13738 Pyr_redox_3 Pyridine nucleotide-disulphide oxidoreductase 8.9E-12 11 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q873E8|GSHR_NEUCR Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 1 468 0.0E+00
sp|Q74ZK4|GSHR_ASHGO Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 1 468 0.0E+00
sp|Q6HA23|GSHR_KLULA Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 1 467 1.0E-176
sp|Q6C5H4|GSHR_YARLI Glutathione reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLR1 PE=3 SV=1 9 468 3.0E-176
sp|Q6FRV2|GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 1 468 4.0E-176
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q873E8|GSHR_NEUCR Glutathione reductase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=gtr-1 PE=3 SV=1 1 468 0.0E+00
sp|Q74ZK4|GSHR_ASHGO Glutathione reductase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GLR1 PE=3 SV=1 1 468 0.0E+00
sp|Q6HA23|GSHR_KLULA Glutathione reductase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLR1 PE=1 SV=1 1 467 1.0E-176
sp|Q6C5H4|GSHR_YARLI Glutathione reductase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GLR1 PE=3 SV=1 9 468 3.0E-176
sp|Q6FRV2|GSHR_CANGA Glutathione reductase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GLR1 PE=3 SV=1 1 468 4.0E-176
sp|P78965|GSHR_SCHPO Glutathione reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgr1 PE=3 SV=2 1 467 1.0E-175
sp|P41921|GSHR_YEAST Glutathione reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLR1 PE=1 SV=2 1 468 2.0E-171
sp|Q6BPI1|GSHR_DEBHA Glutathione reductase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GLR1 PE=3 SV=3 1 468 3.0E-160
sp|P47791|GSHR_MOUSE Glutathione reductase, mitochondrial OS=Mus musculus GN=Gsr PE=1 SV=3 2 468 8.0E-151
sp|A2TIL1|GSHR_CALJA Glutathione reductase, mitochondrial OS=Callithrix jacchus GN=GSR PE=2 SV=1 9 468 6.0E-148
sp|P00390|GSHR_HUMAN Glutathione reductase, mitochondrial OS=Homo sapiens GN=GSR PE=1 SV=2 9 468 9.0E-146
sp|P43783|GSHR_HAEIN Glutathione reductase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gor PE=3 SV=1 4 468 2.0E-145
sp|P06715|GSHR_ECOLI Glutathione reductase OS=Escherichia coli (strain K12) GN=gor PE=1 SV=1 30 468 4.0E-142
sp|Q8T137|GSHR_DICDI Glutathione reductase OS=Dictyostelium discoideum GN=gsr PE=3 SV=2 5 467 2.0E-140
sp|Q60151|GSHR_STRTR Glutathione reductase OS=Streptococcus thermophilus GN=gor PE=3 SV=1 4 468 2.0E-137
sp|P70619|GSHR_RAT Glutathione reductase (Fragment) OS=Rattus norvegicus GN=Gsr PE=2 SV=2 47 468 1.0E-131
sp|D0VWY5|GASHR_MARGR Glutathione amide reductase OS=Marichromatium gracile GN=garB PE=1 SV=1 4 468 9.0E-130
sp|P23189|GSHR_PSEAE Glutathione reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gor PE=3 SV=1 4 468 1.0E-120
sp|P27456|GSHRP_PEA Glutathione reductase, chloroplastic/mitochondrial OS=Pisum sativum GN=GR PE=2 SV=1 7 468 9.0E-108
sp|P80461|GSHRP_TOBAC Glutathione reductase, chloroplastic (Fragment) OS=Nicotiana tabacum GN=GOR PE=1 SV=1 2 468 8.0E-107
sp|Q43621|GSHRC_PEA Glutathione reductase, cytosolic OS=Pisum sativum PE=2 SV=1 7 468 2.0E-106
sp|P42770|GSHRP_ARATH Glutathione reductase, chloroplastic OS=Arabidopsis thaliana GN=EMB2360 PE=2 SV=1 7 468 4.0E-104
sp|P48640|GSHRP_SOYBN Glutathione reductase, chloroplastic OS=Glycine max GN=GR PE=2 SV=1 3 468 8.0E-104
sp|O15770|GSHR_PLAF7 Glutathione reductase OS=Plasmodium falciparum (isolate 3D7) GN=GR3 PE=2 SV=4 30 468 1.0E-103
sp|Q94655|GSHR_PLAFK Glutathione reductase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=GR2 PE=1 SV=3 30 468 2.0E-103
sp|Q43154|GSHRP_SPIOL Glutathione reductase, chloroplastic (Fragment) OS=Spinacia oleracea PE=2 SV=1 7 468 4.0E-103
sp|P48642|GSHRC_ORYSJ Glutathione reductase, cytosolic OS=Oryza sativa subsp. japonica GN=GRC2 PE=2 SV=2 7 468 2.0E-99
sp|O04955|GSHRC_BRARP Glutathione reductase, cytosolic OS=Brassica rapa subsp. pekinensis GN=GR1 PE=2 SV=2 7 468 2.0E-98
sp|Q9Z0J5|TRXR2_RAT Thioredoxin reductase 2, mitochondrial OS=Rattus norvegicus GN=Txnrd2 PE=1 SV=3 6 467 8.0E-98
sp|P48641|GSHRC_ARATH Glutathione reductase, cytosolic OS=Arabidopsis thaliana GN=At3g24170 PE=2 SV=1 7 468 9.0E-98
sp|Q9JLT4|TRXR2_MOUSE Thioredoxin reductase 2, mitochondrial OS=Mus musculus GN=Txnrd2 PE=1 SV=4 6 467 7.0E-97
sp|P48639|GSHR_BURCE Glutathione reductase OS=Burkholderia cepacia GN=gor PE=3 SV=1 7 468 3.0E-96
sp|P48638|GSHR_NOSS1 Glutathione reductase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gor PE=3 SV=2 4 468 2.0E-94
sp|Q9N2I8|TRXR2_BOVIN Thioredoxin reductase 2, mitochondrial OS=Bos taurus GN=TXNRD2 PE=1 SV=2 9 468 1.0E-91
sp|P91938|TRXR1_DROME Thioredoxin reductase 1, mitochondrial OS=Drosophila melanogaster GN=Trxr-1 PE=1 SV=2 7 467 3.0E-91
sp|Q9NNW7|TRXR2_HUMAN Thioredoxin reductase 2, mitochondrial OS=Homo sapiens GN=TXNRD2 PE=1 SV=3 42 468 5.0E-89
sp|B9A1H3|TRXR1_EMIHU Thioredoxin reductase SEP1 OS=Emiliania huxleyi GN=SEP1 PE=1 SV=1 1 467 9.0E-88
sp|P39051|TYTR_TRYBB Trypanothione reductase OS=Trypanosoma brucei brucei GN=TPR PE=1 SV=1 4 468 3.0E-87
sp|P28593|TYTR_TRYCR Trypanothione reductase OS=Trypanosoma cruzi GN=TPR PE=1 SV=1 4 468 4.0E-87
sp|P13110|TYTR_TRYCO Trypanothione reductase OS=Trypanosoma congolense GN=TPR PE=1 SV=1 4 468 4.0E-87
sp|Q99MD6|TRXR3_MOUSE Thioredoxin reductase 3 OS=Mus musculus GN=Txnrd3 PE=1 SV=3 42 468 6.0E-85
sp|P30635|GSHR_CAEEL Probable glutathione reductase 2 OS=Caenorhabditis elegans GN=trxr-2 PE=3 SV=2 9 467 6.0E-84
sp|Q9VNT5|TRXR2_DROME Thioredoxin reductase 2, mitochondrial OS=Drosophila melanogaster GN=Trxr-2 PE=2 SV=1 7 467 6.0E-84
sp|O62768|TRXR1_BOVIN Thioredoxin reductase 1, cytoplasmic OS=Bos taurus GN=TXNRD1 PE=2 SV=3 42 467 1.0E-83
sp|Q9JMH6|TRXR1_MOUSE Thioredoxin reductase 1, cytoplasmic OS=Mus musculus GN=Txnrd1 PE=1 SV=3 42 467 1.0E-83
sp|O89049|TRXR1_RAT Thioredoxin reductase 1, cytoplasmic OS=Rattus norvegicus GN=Txnrd1 PE=1 SV=5 42 467 1.0E-83
sp|Q5NVA2|TRXR1_PONAB Thioredoxin reductase 1, cytoplasmic OS=Pongo abelii GN=TXNRD1 PE=2 SV=3 42 467 9.0E-83
sp|Q9MYY8|TRXR1_PIG Thioredoxin reductase 1, cytoplasmic OS=Sus scrofa GN=TXNRD1 PE=2 SV=3 42 467 1.0E-82
sp|Q16881|TRXR1_HUMAN Thioredoxin reductase 1, cytoplasmic OS=Homo sapiens GN=TXNRD1 PE=1 SV=3 42 467 5.0E-81
sp|P39040|TYTR_CRIFA Trypanothione reductase OS=Crithidia fasciculata GN=TPR PE=1 SV=1 4 468 2.0E-79
sp|Q86VQ6|TRXR3_HUMAN Thioredoxin reductase 3 OS=Homo sapiens GN=TXNRD3 PE=1 SV=4 42 468 8.0E-79
sp|P39050|TYTR_LEIDO Trypanothione reductase OS=Leishmania donovani GN=TPR PE=3 SV=1 4 468 7.0E-78
sp|Q17745|TRXR1_CAEEL Thioredoxin reductase 1 OS=Caenorhabditis elegans GN=trxr-1 PE=2 SV=3 42 467 6.0E-75
sp|Q25861|TRXR_PLAF5 Thioredoxin reductase OS=Plasmodium falciparum (isolate FCH-5) GN=TR PE=1 SV=1 5 467 7.0E-71
sp|P61076|TRXR2_PLAF7 Thioredoxin reductase 2 OS=Plasmodium falciparum (isolate 3D7) GN=trxr2 PE=1 SV=2 5 467 3.0E-70
sp|P14218|DLDH_PSEFL Dihydrolipoyl dehydrogenase OS=Pseudomonas fluorescens GN=lpd PE=1 SV=3 4 464 5.0E-61
sp|Q9I3D1|DLDH2_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdG PE=3 SV=1 4 464 6.0E-61
sp|P18925|DLDH_AZOVI Dihydrolipoyl dehydrogenase OS=Azotobacter vinelandii PE=1 SV=1 4 464 2.0E-60
sp|P31052|DLDH2_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdG PE=1 SV=4 4 464 1.0E-59
sp|P21880|DLDH1_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=pdhD PE=3 SV=1 7 462 7.0E-58
sp|P0A0E4|MERA_STAES Mercuric reductase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=merA PE=3 SV=1 6 464 2.0E-57
sp|P0A0E5|MERA_STAAU Mercuric reductase OS=Staphylococcus aureus GN=merA PE=3 SV=1 6 464 2.0E-57
sp|Q6P6R2|DLDH_RAT Dihydrolipoyl dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Dld PE=1 SV=1 7 462 8.0E-57
sp|O08749|DLDH_MOUSE Dihydrolipoyl dehydrogenase, mitochondrial OS=Mus musculus GN=Dld PE=1 SV=2 3 462 8.0E-57
sp|P49819|DLDH_CANLF Dihydrolipoyl dehydrogenase, mitochondrial OS=Canis lupus familiaris GN=DLD PE=1 SV=1 7 462 2.0E-56
sp|Q811C4|DLDH_MESAU Dihydrolipoyl dehydrogenase, mitochondrial (Fragment) OS=Mesocricetus auratus GN=DLD PE=1 SV=1 7 462 2.0E-56
sp|Q60HG3|DLDH_MACFA Dihydrolipoyl dehydrogenase, mitochondrial OS=Macaca fascicularis GN=DLD PE=2 SV=1 7 462 3.0E-56
sp|P09622|DLDH_HUMAN Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens GN=DLD PE=1 SV=2 7 462 4.0E-56
sp|Q8CIZ7|DLDH_CRIGR Dihydrolipoyl dehydrogenase, mitochondrial OS=Cricetulus griseus GN=DLD PE=2 SV=1 7 462 7.0E-56
sp|P09623|DLDH_PIG Dihydrolipoyl dehydrogenase, mitochondrial OS=Sus scrofa GN=DLD PE=1 SV=1 7 462 2.0E-55
sp|P0A0E7|DLDH_STAAW Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|P0A0E8|DLDH_STAAU Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|Q6GAB8|DLDH_STAAS Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|Q6GHY9|DLDH_STAAR Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|P99084|DLDH_STAAN Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain N315) GN=pdhD PE=1 SV=1 7 462 3.0E-55
sp|P0A0E6|DLDH_STAAM Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|Q5HGY8|DLDH_STAAC Dihydrolipoyl dehydrogenase OS=Staphylococcus aureus (strain COL) GN=pdhD PE=3 SV=1 7 462 3.0E-55
sp|Q9Z773|DLDH_CHLPN Dihydrolipoyl dehydrogenase OS=Chlamydia pneumoniae GN=lpdA PE=3 SV=1 4 462 4.0E-55
sp|Q5R4B1|DLDH_PONAB Dihydrolipoyl dehydrogenase, mitochondrial OS=Pongo abelii GN=DLD PE=2 SV=1 7 462 4.0E-55
sp|Q5UWH2|DLDH3_HALMA Dihydrolipoyl dehydrogenase 3 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA3 PE=3 SV=1 4 465 6.0E-54
sp|O84561|DLDH_CHLTR Dihydrolipoyl dehydrogenase OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=lpdA PE=3 SV=1 9 462 2.0E-53
sp|P11959|DLDH1_GEOSE Dihydrolipoyl dehydrogenase OS=Geobacillus stearothermophilus GN=pdhD PE=1 SV=2 7 462 2.0E-53
sp|Q9PJI3|DLDH_CHLMU Dihydrolipoyl dehydrogenase OS=Chlamydia muridarum (strain MoPn / Nigg) GN=lpdA PE=3 SV=1 9 462 3.0E-53
sp|Q9M5K3|DLDH1_ARATH Dihydrolipoyl dehydrogenase 1, mitochondrial OS=Arabidopsis thaliana GN=LPD1 PE=1 SV=2 23 464 4.0E-52
sp|P16171|MERA_BACCE Mercuric reductase OS=Bacillus cereus GN=merA PE=1 SV=1 7 464 3.0E-51
sp|Q8NTE1|DLDH_CORGL Dihydrolipoyl dehydrogenase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=lpd PE=1 SV=1 4 462 3.0E-50
sp|P85207|DLDH_THESS Dihydrolipoyl dehydrogenase OS=Thermus scotoductus (strain ATCC 700910 / SA-01) GN=lpd PE=1 SV=2 6 465 3.0E-50
sp|Q9I1L9|DLDH1_PSEAE Dihydrolipoyl dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpdV PE=1 SV=1 1 462 4.0E-50
sp|A8MS68|PLPD1_ARATH Dihydrolipoyl dehydrogenase 1, chloroplastic OS=Arabidopsis thaliana GN=LPD1 PE=2 SV=1 31 464 9.0E-50
sp|P31023|DLDH_PEA Dihydrolipoyl dehydrogenase, mitochondrial OS=Pisum sativum GN=LPD PE=1 SV=2 23 464 3.0E-49
sp|O17953|DLDH_CAEEL Dihydrolipoyl dehydrogenase, mitochondrial OS=Caenorhabditis elegans GN=dld-1 PE=3 SV=2 5 462 2.0E-48
sp|Q41219|LEGRE_SOYBN Leghemoglobin reductase OS=Glycine max GN=FLBR PE=1 SV=1 23 462 2.0E-48
sp|Q54465|MERA_SHEPU Mercuric reductase OS=Shewanella putrefaciens GN=merA PE=3 SV=1 12 442 2.0E-48
sp|Q9M5K2|DLDH2_ARATH Dihydrolipoyl dehydrogenase 2, mitochondrial OS=Arabidopsis thaliana GN=LPD2 PE=1 SV=1 23 464 1.0E-47
sp|Q54EW8|DLDH_DICDI Dihydrolipoyl dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=lpd PE=3 SV=1 23 462 2.0E-47
sp|Q9HUY1|DLDH3_PSEAE Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lpd3 PE=3 SV=1 4 464 2.0E-47
sp|F4JLP5|PLPD2_ARATH Dihydrolipoyl dehydrogenase 2, chloroplastic OS=Arabidopsis thaliana GN=LPD2 PE=2 SV=2 31 462 6.0E-47
sp|O05940|DLDH_RHIEC Dihydrolipoyl dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=lpdA PE=3 SV=2 9 464 1.0E-46
sp|O34324|DLDH3_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=acoL PE=3 SV=1 29 464 2.0E-46
sp|Q9SPB1|LEGRE_VIGUN Leghemoglobin reductase OS=Vigna unguiculata GN=FLBR PE=1 SV=1 23 462 3.0E-46
sp|P31046|DLDH3_PSEPU Dihydrolipoyl dehydrogenase 3 OS=Pseudomonas putida GN=lpd3 PE=1 SV=1 22 464 3.0E-46
sp|Q52109|MERA_ACICA Mercuric reductase OS=Acinetobacter calcoaceticus GN=merA PE=3 SV=1 6 442 1.0E-45
sp|Q9HN74|DLDH_HALSA Dihydrolipoyl dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=lpdA PE=3 SV=1 4 462 2.0E-45
sp|P94188|MERA_ALCSP Mercuric reductase OS=Alcaligenes sp. GN=merA PE=3 SV=1 16 442 2.0E-45
sp|P30341|MERA_STRLI Mercuric reductase OS=Streptomyces lividans GN=merA PE=2 SV=1 31 464 7.0E-45
sp|Q04829|DLDH_HALVD Dihydrolipoyl dehydrogenase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=lpdA PE=1 SV=3 4 465 8.0E-45
sp|P17239|MERA_ACIFR Mercuric reductase OS=Acidithiobacillus ferrooxidans GN=merA PE=1 SV=2 6 442 9.0E-45
sp|P00392|MERA_PSEAI Mercuric reductase OS=Pseudomonas aeruginosa GN=merA PE=1 SV=1 8 442 2.0E-44
sp|P72740|DLDH_SYNY3 Dihydrolipoyl dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lpdA PE=1 SV=3 4 464 2.0E-44
sp|P9WHH3|MTR_MYCTU Mycothione reductase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtr PE=1 SV=1 9 462 3.0E-44
sp|P9WHH2|MTR_MYCTO Mycothione reductase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtr PE=3 SV=1 9 462 3.0E-44
sp|P08332|MERA_SHIFL Mercuric reductase OS=Shigella flexneri GN=merA PE=3 SV=1 16 442 4.0E-44
sp|O18480|DLDH_MANSE Dihydrolipoyl dehydrogenase OS=Manduca sexta PE=2 SV=1 5 464 6.0E-43
sp|Q50068|DLDH_MYCLE Dihydrolipoyl dehydrogenase OS=Mycobacterium leprae (strain TN) GN=lpd PE=3 SV=1 9 464 6.0E-43
sp|P09624|DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPD1 PE=1 SV=1 4 462 1.0E-42
sp|P50970|DLDH_ZYMMO Dihydrolipoyl dehydrogenase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=lpd PE=3 SV=3 9 464 1.0E-42
sp|Q5UYG6|DLDH2_HALMA Dihydrolipoyl dehydrogenase 2 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=lpdA2 PE=3 SV=1 4 462 2.0E-42
sp|O00087|DLDH_SCHPO Dihydrolipoyl dehydrogenase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dld1 PE=2 SV=2 7 462 2.0E-42
sp|P94702|MERA_ENTAG Mercuric reductase OS=Enterobacter agglomerans GN=merA PE=3 SV=1 6 442 3.0E-42
sp|P95596|DLDH_RHOCA Dihydrolipoyl dehydrogenase OS=Rhodobacter capsulatus GN=lpd PE=3 SV=1 28 462 7.0E-42
sp|P09063|DLDH1_PSEPU Dihydrolipoyl dehydrogenase OS=Pseudomonas putida GN=lpdV PE=1 SV=1 23 462 2.0E-41
sp|Q51772|MERA_PSEFL Mercuric reductase OS=Pseudomonas fluorescens GN=merA PE=3 SV=1 16 442 3.0E-41
sp|P0A9P3|DLDH_SHIFL Dihydrolipoyl dehydrogenase OS=Shigella flexneri GN=lpdA PE=3 SV=2 11 464 3.0E-41
sp|P0A9P0|DLDH_ECOLI Dihydrolipoyl dehydrogenase OS=Escherichia coli (strain K12) GN=lpdA PE=1 SV=2 11 464 3.0E-41
sp|P0A9P1|DLDH_ECOL6 Dihydrolipoyl dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lpdA PE=3 SV=2 11 464 3.0E-41
sp|P0A9P2|DLDH_ECO57 Dihydrolipoyl dehydrogenase OS=Escherichia coli O157:H7 GN=lpdA PE=3 SV=2 11 464 3.0E-41
sp|P52992|DLDH_CUPNH Dihydrolipoyl dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=odhL PE=3 SV=2 4 462 2.0E-40
sp|P9WHH5|STHA_MYCTU Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=sthA PE=1 SV=1 6 462 6.0E-40
sp|P9WHH4|STHA_MYCTO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=sthA PE=3 SV=1 6 462 6.0E-40
sp|A5U665|STHA_MYCTA Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=sthA PE=3 SV=1 6 462 6.0E-40
sp|C1AFH2|STHA_MYCBT Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=sthA PE=3 SV=1 6 462 6.0E-40
sp|A1KM51|STHA_MYCBP Soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=sthA PE=3 SV=1 6 462 6.0E-40
sp|P66007|STHA_MYCBO Probable soluble pyridine nucleotide transhydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=sthA PE=3 SV=1 6 462 6.0E-40
sp|P43784|DLDH_HAEIN Dihydrolipoyl dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lpdA PE=3 SV=2 11 464 5.0E-39
sp|Q04933|DLDH_TRYBB Dihydrolipoyl dehydrogenase OS=Trypanosoma brucei brucei PE=3 SV=1 23 462 5.0E-39
sp|Q8K9T7|DLDH_BUCAP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lpdA PE=3 SV=1 9 464 6.0E-39
sp|A6V3A6|STHA_PSEA7 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=sthA PE=3 SV=1 7 462 8.0E-39
sp|P90597|DLDH_TRYCR Dihydrolipoyl dehydrogenase OS=Trypanosoma cruzi GN=LPD PE=1 SV=1 23 464 1.0E-38
sp|P57112|STHA_PSEAE Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=sthA PE=1 SV=2 7 462 1.0E-38
sp|Q02PF5|STHA_PSEAB Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=sthA PE=3 SV=1 7 462 1.0E-38
sp|B7UZU5|STHA_PSEA8 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=sthA PE=3 SV=1 7 462 1.0E-38
sp|O50286|DLDH_VIBPA Dihydrolipoyl dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lpd PE=3 SV=2 11 464 2.0E-38
sp|Q87KN5|STHA_VIBPA Soluble pyridine nucleotide transhydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=sthA PE=3 SV=1 9 462 2.0E-38
sp|Q7MQ83|STHA_VIBVY Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain YJ016) GN=sthA PE=3 SV=1 9 462 3.0E-38
sp|Q8DD46|STHA_VIBVU Soluble pyridine nucleotide transhydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=sthA PE=3 SV=1 9 462 3.0E-38
sp|P75393|DLDH_MYCPN Dihydrolipoyl dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pdhD PE=3 SV=1 7 462 4.0E-38
sp|P9WHH9|DLDH_MYCTU Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdC PE=1 SV=1 9 464 5.0E-38
sp|P9WHH8|DLDH_MYCTO Dihydrolipoyl dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdC PE=3 SV=1 9 464 5.0E-38
sp|P66005|DLDH_MYCBO Dihydrolipoyl dehydrogenase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lpd PE=3 SV=1 9 464 5.0E-38
sp|Q9KPF6|DLDH_VIBCH Dihydrolipoyl dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lpd PE=3 SV=1 11 464 5.0E-38
sp|Q8KCW2|DLDH_CHLTE Dihydrolipoyl dehydrogenase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lpd PE=3 SV=1 4 462 6.0E-38
sp|Q4ZV77|STHA_PSEU2 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=sthA PE=3 SV=2 7 462 6.0E-38
sp|C3LPZ2|STHA_VIBCM Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=sthA PE=3 SV=1 9 464 7.0E-38
sp|P50529|STHA_VIBCH Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=sthA PE=3 SV=2 9 464 7.0E-38
sp|A5F4K5|STHA_VIBC3 Soluble pyridine nucleotide transhydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=sthA PE=3 SV=1 9 464 7.0E-38
sp|Q48KI8|STHA_PSE14 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=sthA PE=3 SV=1 7 462 9.0E-38
sp|B4F1H1|STHA_PROMH Soluble pyridine nucleotide transhydrogenase OS=Proteus mirabilis (strain HI4320) GN=sthA PE=3 SV=1 9 462 1.0E-37
sp|Q884I6|STHA_PSESM Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=sthA PE=3 SV=3 7 462 2.0E-37
sp|B1J606|STHA_PSEPW Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain W619) GN=sthA PE=3 SV=1 7 462 4.0E-37
sp|C3K4W1|STHA_PSEFS Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=sthA PE=3 SV=1 7 462 8.0E-37
sp|B7VM91|STHA_VIBTL Soluble pyridine nucleotide transhydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=sthA PE=3 SV=1 9 462 8.0E-37
sp|O05139|STHA_PSEFL Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens GN=sthA PE=1 SV=3 7 462 9.0E-37
sp|Q88KY8|STHA_PSEPK Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain KT2440) GN=sthA PE=3 SV=3 7 462 3.0E-36
sp|A5W6F5|STHA_PSEP1 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=sthA PE=3 SV=1 7 462 3.0E-36
sp|Q48A14|STHA_COLP3 Soluble pyridine nucleotide transhydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=sthA PE=3 SV=1 7 462 4.0E-36
sp|B0KH90|STHA_PSEPG Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas putida (strain GB-1) GN=sthA PE=3 SV=1 7 462 5.0E-36
sp|A8GL77|STHA_SERP5 Soluble pyridine nucleotide transhydrogenase OS=Serratia proteamaculans (strain 568) GN=sthA PE=3 SV=1 9 462 6.0E-36
sp|B2VGA0|STHA_ERWT9 Soluble pyridine nucleotide transhydrogenase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=sthA PE=3 SV=1 5 462 9.0E-36
sp|A4XSQ1|STHA_PSEMY Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas mendocina (strain ymp) GN=sthA PE=3 SV=1 7 462 9.0E-36
sp|P54533|DLDH2_BACSU Dihydrolipoyl dehydrogenase OS=Bacillus subtilis (strain 168) GN=bfmBC PE=3 SV=1 4 464 1.0E-35
sp|Q3K9F5|STHA_PSEPF Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf0-1) GN=sthA PE=3 SV=1 7 462 1.0E-35
sp|Q4KFA6|STHA_PSEF5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=sthA PE=3 SV=1 7 462 2.0E-35
sp|Q7MBG9|STHA_PHOLL Soluble pyridine nucleotide transhydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=sthA PE=3 SV=1 9 462 4.0E-35
sp|Q1I7F0|STHA_PSEE4 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas entomophila (strain L48) GN=sthA PE=3 SV=1 7 462 4.0E-35
sp|Q5E212|STHA_VIBF1 Soluble pyridine nucleotide transhydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=sthA PE=3 SV=2 9 462 5.0E-35
sp|O50311|DLDH_CHLP8 Dihydrolipoyl dehydrogenase OS=Chlorobaculum parvum (strain NCIB 8327) GN=lpd PE=3 SV=2 5 462 5.0E-35
sp|Q9XBQ9|STHA_AZOVI Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii GN=sthA PE=1 SV=1 7 462 8.0E-35
sp|C1DR10|STHA_AZOVD Soluble pyridine nucleotide transhydrogenase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=sthA PE=3 SV=1 7 462 8.0E-35
sp|P57303|DLDH_BUCAI Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lpdA PE=3 SV=1 11 464 9.0E-35
sp|Q6CZB1|STHA_PECAS Soluble pyridine nucleotide transhydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=sthA PE=3 SV=1 7 462 3.0E-34
sp|A6VW16|STHA_MARMS Soluble pyridine nucleotide transhydrogenase OS=Marinomonas sp. (strain MWYL1) GN=sthA PE=3 SV=1 5 462 7.0E-34
sp|B5REZ6|STHA_SALG2 Soluble pyridine nucleotide transhydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=sthA PE=3 SV=1 3 462 1.0E-33
sp|A4VMU6|STHA_PSEU5 Soluble pyridine nucleotide transhydrogenase OS=Pseudomonas stutzeri (strain A1501) GN=sthA PE=3 SV=1 7 462 2.0E-33
sp|Q83MI1|STHA_SHIFL Soluble pyridine nucleotide transhydrogenase OS=Shigella flexneri GN=sthA PE=3 SV=1 3 462 2.0E-33
sp|A8AKW0|STHA_CITK8 Soluble pyridine nucleotide transhydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=sthA PE=3 SV=1 3 462 2.0E-33
sp|C0Q478|STHA_SALPC Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=sthA PE=3 SV=1 3 462 3.0E-33
sp|Q57H91|STHA_SALCH Soluble pyridine nucleotide transhydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=sthA PE=3 SV=1 3 462 3.0E-33
sp|B1LNS2|STHA_ECOSM Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=sthA PE=3 SV=1 3 462 3.0E-33
sp|Q8FB93|STHA_ECOL6 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sthA PE=3 SV=3 3 462 3.0E-33
sp|B1IVB6|STHA_ECOLC Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=sthA PE=3 SV=1 3 462 3.0E-33
sp|A8A770|STHA_ECOHS Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=sthA PE=3 SV=1 3 462 3.0E-33
sp|B5XZ14|STHA_KLEP3 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae (strain 342) GN=sthA PE=3 SV=1 7 462 4.0E-33
sp|Q0TA96|STHA_ECOL5 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7LUN3|STHA_ESCF3 Soluble pyridine nucleotide transhydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|Q1R3U7|STHA_ECOUT Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B6I5I0|STHA_ECOSE Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain SE11) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7NFR2|STHA_ECOLU Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|P27306|STHA_ECOLI Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12) GN=sthA PE=1 SV=5 3 462 4.0E-33
sp|A1AIE2|STHA_ECOK1 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O1:K1 / APEC GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B1XBX3|STHA_ECODH Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|C5A0R1|STHA_ECOBW Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7M718|STHA_ECO8A Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O8 (strain IAI1) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7NU38|STHA_ECO7I Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B5Z064|STHA_ECO5E Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7LA64|STHA_ECO55 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7MIA0|STHA_ECO45 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|A7ZUI2|STHA_ECO24 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=sthA PE=3 SV=1 3 462 4.0E-33
sp|B7UNU0|STHA_ECO27 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=sthA PE=3 SV=1 3 462 5.0E-33
sp|P66008|STHA_SALTY Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=sthA PE=3 SV=2 3 462 5.0E-33
sp|P66009|STHA_SALTI Soluble pyridine nucleotide transhydrogenase OS=Salmonella typhi GN=sthA PE=3 SV=2 3 462 5.0E-33
sp|B5BJN6|STHA_SALPK Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=sthA PE=3 SV=1 3 462 5.0E-33
sp|A9N0H2|STHA_SALPB Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=sthA PE=3 SV=1 3 462 5.0E-33
sp|Q5PK71|STHA_SALPA Soluble pyridine nucleotide transhydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=sthA PE=3 SV=1 3 462 5.0E-33
sp|B5QXQ7|STHA_SALEP Soluble pyridine nucleotide transhydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=sthA PE=3 SV=1 3 462 5.0E-33
sp|B2TWF7|STHA_SHIB3 Soluble pyridine nucleotide transhydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=sthA PE=3 SV=1 3 462 7.0E-33
sp|P47513|DLDH_MYCGE Dihydrolipoyl dehydrogenase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pdhD PE=3 SV=1 7 466 7.0E-33
sp|A1JI37|STHA_YERE8 Soluble pyridine nucleotide transhydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=sthA PE=3 SV=1 9 462 1.0E-32
sp|A6TGE6|STHA_KLEP7 Soluble pyridine nucleotide transhydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=sthA PE=3 SV=1 7 462 1.0E-32
sp|B7MR55|STHA_ECO81 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O81 (strain ED1a) GN=sthA PE=3 SV=1 3 462 1.0E-32
sp|A1U1Y5|STHA_MARHV Soluble pyridine nucleotide transhydrogenase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=sthA PE=3 SV=1 9 462 2.0E-32
sp|A4WG49|STHA_ENT38 Soluble pyridine nucleotide transhydrogenase OS=Enterobacter sp. (strain 638) GN=sthA PE=3 SV=1 5 462 3.0E-32
sp|B1JQ50|STHA_YERPY Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|Q66G61|STHA_YERPS Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|A4TRG4|STHA_YERPP Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis (strain Pestoides F) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|Q1CNP4|STHA_YERPN Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|A9R6N5|STHA_YERPG Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|Q8ZA97|STHA_YERPE Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|B2JZF3|STHA_YERPB Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|Q1CBU5|STHA_YERPA Soluble pyridine nucleotide transhydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|A7FD10|STHA_YERP3 Soluble pyridine nucleotide transhydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=sthA PE=3 SV=1 9 462 5.0E-32
sp|Q8X727|STHA_ECO57 Soluble pyridine nucleotide transhydrogenase OS=Escherichia coli O157:H7 GN=sthA PE=3 SV=3 3 462 5.0E-32
sp|P77212|RCLA_ECOLI Probable pyridine nucleotide-disulfide oxidoreductase RclA OS=Escherichia coli (strain K12) GN=rclA PE=2 SV=2 11 464 5.0E-32
sp|Q6LLT9|STHA_PHOPR Soluble pyridine nucleotide transhydrogenase OS=Photobacterium profundum GN=sthA PE=3 SV=1 9 462 7.0E-32
sp|Q1QX78|STHA_CHRSD Soluble pyridine nucleotide transhydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=sthA PE=3 SV=1 7 462 8.0E-32
sp|Q2NQZ3|STHA_SODGM Soluble pyridine nucleotide transhydrogenase OS=Sodalis glossinidius (strain morsitans) GN=sthA PE=3 SV=1 7 462 2.0E-31
sp|C4K3I8|STHA_HAMD5 Soluble pyridine nucleotide transhydrogenase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=sthA PE=3 SV=1 7 462 7.0E-31
sp|Q89AQ8|DLDH_BUCBP Dihydrolipoyl dehydrogenase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=lpdA PE=3 SV=1 4 464 7.0E-30
sp|Q02733|IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC15 PE=1 SV=1 9 464 4.0E-28
sp|Q2SIP2|STHA_HAHCH Soluble pyridine nucleotide transhydrogenase OS=Hahella chejuensis (strain KCTC 2396) GN=sthA PE=3 SV=1 25 462 6.0E-28
sp|P9WHH7|LPDA_MYCTU NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lpdA PE=1 SV=1 11 381 9.0E-27
sp|P9WHH6|LPDA_MYCTO NAD(P)H dehydrogenase (quinone) OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lpdA PE=3 SV=1 11 381 9.0E-27
sp|P35484|DLDH_ACHLA Dihydrolipoyl dehydrogenase (Fragment) OS=Acholeplasma laidlawii GN=pdhD PE=3 SV=1 23 329 6.0E-26
sp|Q56839|XECC_XANP2 2-oxopropyl-CoM reductase, carboxylating OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=xecC PE=1 SV=1 6 468 3.0E-22
sp|P08662|MERA_SERMA Mercuric reductase (Fragments) OS=Serratia marcescens GN=merA PE=3 SV=2 16 266 8.0E-22
sp|Q5XC60|NAOX_STRP6 Probable NADH oxidase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=M6_Spy0868 PE=1 SV=1 131 446 6.0E-13
sp|Q8U1M0|CDR_PYRFU Coenzyme A disulfide reductase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF1186 PE=3 SV=1 156 396 1.0E-12
sp|Q9UYU5|CDR_PYRAB Coenzyme A disulfide reductase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB14120 PE=3 SV=1 156 443 4.0E-11
sp|Q5JGP4|CDR_THEKO Coenzyme A disulfide reductase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK1299 PE=3 SV=1 122 396 8.0E-11
sp|P08655|YMER_STAAU Uncharacterized 19.7 kDa protein in mercuric resistance operon OS=Staphylococcus aureus PE=4 SV=1 285 467 1.0E-10
sp|Q58065|NAOX_METJA Putative NADH oxidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0649 PE=3 SV=2 103 467 2.0E-10
sp|B4S9F8|FENR_PROA2 Ferredoxin--NADP reductase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=Paes_1610 PE=3 SV=1 3 322 8.0E-07
sp|O52582|CDR_STAA8 Coenzyme A disulfide reductase OS=Staphylococcus aureus (strain NCTC 8325) GN=cdr PE=1 SV=3 168 337 2.0E-06
sp|P08201|NIRB_ECOLI Nitrite reductase (NADH) large subunit OS=Escherichia coli (strain K12) GN=nirB PE=3 SV=4 101 319 2.0E-06
sp|B2GEF7|FENR_LACF3 Ferredoxin--NADP reductase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=LAF_1703 PE=3 SV=1 129 320 2.0E-06
sp|Q67QU3|FENR_SYMTH Ferredoxin--NADP reductase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=STH965 PE=3 SV=1 131 322 5.0E-06
sp|A2RIB7|NAOX_LACLM NADH oxidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=noxE PE=1 SV=1 143 446 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0045454 cell redox homeostasis Yes
GO:0050789 regulation of biological process No
GO:0019725 cellular homeostasis No
GO:0065007 biological regulation No
GO:0065008 regulation of biological quality No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0042592 homeostatic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1376
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|646
Ophiocordyceps australis map64 (Brazil) OphauB2|5972
Ophiocordyceps camponoti-floridani Ophcf2|05701
Ophiocordyceps camponoti-rufipedis Ophun1|1357 (this protein)
Ophiocordyceps kimflemingae Ophio5|3552
Ophiocordyceps subramaniannii Hirsu2|10811

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1357
MAPITKDVDYLVLGGGSGGLASARMAGSKYGVKTLIVEARRLGGTCVNVGCVPKKVTYNAAAIAESIHDAAAYGF
SVKETAPFNWSSFKAKRDAYVKRLNGIYERNLNNDGVTYLHGWGRLLSRNQAEVTLDDGSKVLVNAKKMLIAVGG
RPNPPPPIPGAEHGINSDGFFDIDRLPKRVVIVGAGYIAVEFAGMFNALGTETHLMIRHDTFLRNFDPMVQELVT
REYERLGVRLHKRCNTSKVEKAADGKLTVSYRDDAGHESSVSDVDHLIWATGRQPMTRDIGLEEAGVKLNEKGQV
VVDEMQKSSVDNIFALGDVVGHVELTPVAIAAGRRLSHRLFGTDCKGATLDYSNIPSVVFAHPEIGTIGLTEPQA
VEKYGKDGIKVYKTTFTAMHYAMMEQEDKGPTAYKLIVTGPDEKVVGLHMLGQGSAEILQGFGVAIKMGATKADF
DNCVAIHPTSAEELVTLK*
Coding >Ophun1|1357
ATGGCTCCCATCACCAAGGACGTCGACTACCTCGTCCTCGGAGGCGGTAGCGGCGGCCTGGCCTCGGCACGCATG
GCCGGCTCCAAGTACGGCGTCAAGACGTTGATTGTAGAGGCGAGGCGGTTGGGAGGGACCTGCGTCAATGTCGGC
TGTGTGCCCAAAAAGGTCACCTACAACGCTGCCGCCATCGCCGAGTCGATCCACGATGCCGCTGCCTACGGCTTC
TCCGTCAAAGAAACGGCGCCTTTCAACTGGTCCTCTTTCAAGGCCAAGCGTGACGCCTACGTCAAACGCCTCAAC
GGCATCTACGAGCGCAACCTGAATAACGACGGCGTCACCTACCTCCACGGCTGGGGCCGCCTGTTGTCTCGGAAC
CAGGCCGAGGTGACGCTCGACGACGGGTCAAAGGTGCTGGTCAACGCCAAGAAGATGCTCATCGCCGTCGGTGGC
CGGCCCAATCCTCCGCCGCCGATCCCCGGTGCCGAGCACGGCATCAACAGCGACGGCTTCTTCGACATCGACCGG
CTGCCCAAGCGCGTCGTCATCGTCGGTGCTGGCTACATCGCCGTCGAGTTCGCCGGCATGTTCAACGCCCTCGGC
ACTGAGACGCATCTGATGATCCGCCACGACACGTTCCTGCGCAACTTTGACCCCATGGTCCAGGAGTTGGTCACG
CGCGAGTACGAGCGGCTCGGCGTCCGGCTGCATAAGCGCTGCAACACGAGCAAGGTGGAAAAGGCAGCCGACGGG
AAGCTCACCGTCAGCTATCGCGACGACGCCGGCCACGAGAGCTCCGTGTCCGACGTCGATCATCTGATCTGGGCC
ACGGGTCGTCAACCCATGACGCGTGACATCGGCCTCGAGGAGGCAGGCGTGAAGCTCAACGAAAAGGGGCAGGTG
GTGGTCGATGAGATGCAAAAGTCAAGCGTCGACAACATCTTTGCCCTCGGAGACGTCGTGGGCCACGTCGAGCTC
ACGCCTGTAGCCATTGCTGCCGGCCGCAGGCTGTCGCACCGCCTCTTCGGCACCGACTGCAAGGGGGCGACGCTC
GACTACAGCAACATTCCCTCGGTCGTCTTCGCCCACCCGGAGATTGGCACCATCGGGTTGACGGAGCCGCAGGCG
GTGGAAAAGTACGGCAAGGACGGCATCAAGGTGTACAAGACGACCTTTACCGCCATGCACTACGCCATGATGGAG
CAGGAGGACAAGGGCCCGACTGCCTACAAGCTCATCGTGACGGGTCCGGACGAAAAGGTGGTCGGTCTTCATATG
CTGGGTCAGGGCAGTGCCGAGATCCTGCAGGGCTTCGGCGTGGCCATCAAGATGGGTGCGACAAAGGCCGACTTT
GACAACTGTGTGGCCATCCATCCGACCAGTGCCGAGGAGCTGGTGACGCTCAAGTAG
Transcript >Ophun1|1357
ATGGCTCCCATCACCAAGGACGTCGACTACCTCGTCCTCGGAGGCGGTAGCGGCGGCCTGGCCTCGGCACGCATG
GCCGGCTCCAAGTACGGCGTCAAGACGTTGATTGTAGAGGCGAGGCGGTTGGGAGGGACCTGCGTCAATGTCGGC
TGTGTGCCCAAAAAGGTCACCTACAACGCTGCCGCCATCGCCGAGTCGATCCACGATGCCGCTGCCTACGGCTTC
TCCGTCAAAGAAACGGCGCCTTTCAACTGGTCCTCTTTCAAGGCCAAGCGTGACGCCTACGTCAAACGCCTCAAC
GGCATCTACGAGCGCAACCTGAATAACGACGGCGTCACCTACCTCCACGGCTGGGGCCGCCTGTTGTCTCGGAAC
CAGGCCGAGGTGACGCTCGACGACGGGTCAAAGGTGCTGGTCAACGCCAAGAAGATGCTCATCGCCGTCGGTGGC
CGGCCCAATCCTCCGCCGCCGATCCCCGGTGCCGAGCACGGCATCAACAGCGACGGCTTCTTCGACATCGACCGG
CTGCCCAAGCGCGTCGTCATCGTCGGTGCTGGCTACATCGCCGTCGAGTTCGCCGGCATGTTCAACGCCCTCGGC
ACTGAGACGCATCTGATGATCCGCCACGACACGTTCCTGCGCAACTTTGACCCCATGGTCCAGGAGTTGGTCACG
CGCGAGTACGAGCGGCTCGGCGTCCGGCTGCATAAGCGCTGCAACACGAGCAAGGTGGAAAAGGCAGCCGACGGG
AAGCTCACCGTCAGCTATCGCGACGACGCCGGCCACGAGAGCTCCGTGTCCGACGTCGATCATCTGATCTGGGCC
ACGGGTCGTCAACCCATGACGCGTGACATCGGCCTCGAGGAGGCAGGCGTGAAGCTCAACGAAAAGGGGCAGGTG
GTGGTCGATGAGATGCAAAAGTCAAGCGTCGACAACATCTTTGCCCTCGGAGACGTCGTGGGCCACGTCGAGCTC
ACGCCTGTAGCCATTGCTGCCGGCCGCAGGCTGTCGCACCGCCTCTTCGGCACCGACTGCAAGGGGGCGACGCTC
GACTACAGCAACATTCCCTCGGTCGTCTTCGCCCACCCGGAGATTGGCACCATCGGGTTGACGGAGCCGCAGGCG
GTGGAAAAGTACGGCAAGGACGGCATCAAGGTGTACAAGACGACCTTTACCGCCATGCACTACGCCATGATGGAG
CAGGAGGACAAGGGCCCGACTGCCTACAAGCTCATCGTGACGGGTCCGGACGAAAAGGTGGTCGGTCTTCATATG
CTGGGTCAGGGCAGTGCCGAGATCCTGCAGGGCTTCGGCGTGGCCATCAAGATGGGTGCGACAAAGGCCGACTTT
GACAACTGTGTGGCCATCCATCCGACCAGTGCCGAGGAGCTGGTGACGCTCAAGTAG
Gene >Ophun1|1357
ATGGCTCCCATCACCAAGGACGTCGACTACCTCGTCCTCGGAGGCGGTAGCGGCGGCCTGGCCTCGGCACGCATG
GCCGGCTCCAAGTACGGCGTCAAGACGTTGATTGTAGAGGCGAGGCGGTTGGGAGGGACCTGCGTCAATGTCGGG
TAAGTCGAAACGTGTTTGTTGTCGTCTGTCTGTCTGTCTGTCTGTCTCCTGTCTAATCAGCCGTTCCTCAGCTGT
GTGCCCAAAAAGGTCACCTACAACGCTGCCGCCATCGCCGAGTCGATCCACGATGCCGCTGCCTACGGCTTCTCC
GTCAAAGAAACGGCGCCTTTCAACTGGTCCTCTTTCAAGGCCAAGCGTGACGCCTACGTCAAACGCCTCAACGGC
ATCTACGAGCGCAACCTGAATAACGACGGCGTCACCTACCTCCACGGCTGGGGCCGCCTGTTGTCTCGGAACCAG
GCCGAGGTGACGCTCGACGACGGGTCAAAGGTGCTGGTCAACGCCAAGAAGATGCTCATCGCCGTCGGTGGCCGG
CCCAATCCTCCGCCGCCGATCCCCGGTGCCGAGCACGGCATCAACAGCGACGGCTTCTTCGACATCGACCGGCTG
CCCAAGCGCGTCGTCATCGTCGGTGCTGGCTACATCGCCGTCGAGTTCGCCGGCATGTTCAACGCCCTCGGCACT
GAGACGCATCTGATGATCCGCCACGACACGTTCCTGCGCAACTTTGACCCCATGGTCCAGGAGTTGGTCACGCGC
GAGTACGAGCGGCTCGGCGTCCGGCTGCATAAGCGCTGCAACACGAGCAAGGTGGAAAAGGCAGCCGACGGGAAG
CTCACCGTCAGCTATCGCGACGACGCCGGCCACGAGAGCTCCGTGTCCGACGTCGATCATCTGATCTGGGCCACG
GGTCGTCAACCCATGACGCGTGACATCGGCCTCGAGGAGGCAGGCGTGAAGCTCAACGAAAAGGGGCAGGTGGTG
GTCGATGAGATGCAAAAGTCAAGCGTCGACAACATCTTTGCCCTCGGAGACGTCGTGGGCCACGTCGAGCTCACG
CCTGTAGCCATTGCTGCCGGCCGCAGGCTGTCGCACCGCCTCTTCGGCACCGACTGCAAGGGGGCGACGCTCGAC
TACAGCAACATTCCCTCGGTCGTCTTCGCCCACCCGGAGATTGGCACCATCGGGTTGACGGAGCCGCAGGCGGTG
GAAAAGTACGGCAAGGACGGCATCAAGGTGTACAAGACGACCTTTACCGCCATGCACTACGCCATGATGGAGCAG
GAGGACAAGGGCCCGACTGCCTACAAGCTCATCGTGACGGGTCCGGACGAAAAGGTGGTCGGTCTTCATATGCTG
GGTCAGGGCAGTGCCGAGATCCTGCAGGGCTTCGGCGTGGCCATCAAGATGGGTGCGACAAAGGCCGACTTTGAC
AACTGTGTGGCCATCCATCCGACCAGTGCCGAGGAGCTGGTGACGCTCAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail