Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1350
Gene name
LocationContig_1534:327..795
Strand+
Gene length (bp)468
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01876 RNase_P_p30 RNase P subunit p30 2.7E-17 1 63

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87120|RNP3_SCHPO Probable ribonuclease P protein subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3A12.04c PE=3 SV=2 5 87 2.0E-13

GO

GO Term Description Terminal node
GO:0008033 tRNA processing Yes
GO:0044237 cellular metabolic process No
GO:0034470 ncRNA processing No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0006396 RNA processing No
GO:0008152 metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016070 RNA metabolic process No
GO:0006399 tRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4630
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4678
Ophiocordyceps australis map64 (Brazil) OphauB2|4498
Ophiocordyceps camponoti-floridani Ophcf2|03307
Ophiocordyceps camponoti-rufipedis Ophun1|1350 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|751
Ophiocordyceps kimflemingae Ophio5|3530
Ophiocordyceps subramaniannii Hirsu2|9723

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1350
MLSADARGRANFIGNLTSLVRATRGRGFVVSSEAKTALALRAPADVVNLLSVWGLANERGLEGLRAIPRSVVVNE
AIKRRGFRGVVDVVQVASPRPEAAAETVSPPPHDAVTSQKRKSADAGPHSAAQPLSKRQAKRMKLAARAAAVEKG
QAGAP*
Coding >Ophun1|1350
ATGTTGAGTGCTGATGCTCGTGGCCGCGCAAACTTCATCGGTAACCTTACAAGTCTTGTCCGCGCCACTCGCGGT
CGTGGCTTCGTCGTCAGCAGCGAGGCCAAGACGGCTTTGGCTCTTCGCGCCCCGGCTGACGTGGTCAACCTGTTG
AGCGTCTGGGGGCTCGCCAACGAGAGGGGACTCGAGGGACTGCGCGCCATACCGAGGAGCGTCGTCGTCAACGAG
GCCATCAAGAGACGTGGCTTCCGCGGCGTCGTCGATGTCGTCCAAGTCGCCTCCCCCCGCCCAGAGGCTGCTGCC
GAGACGGTGTCGCCGCCGCCGCACGATGCCGTTACGAGCCAGAAACGGAAAAGCGCAGACGCGGGTCCGCACTCG
GCTGCCCAGCCTCTGAGCAAGCGGCAGGCCAAGAGGATGAAGTTGGCTGCTCGGGCGGCCGCGGTTGAAAAGGGG
CAGGCTGGAGCACCGTGA
Transcript >Ophun1|1350
ATGTTGAGTGCTGATGCTCGTGGCCGCGCAAACTTCATCGGTAACCTTACAAGTCTTGTCCGCGCCACTCGCGGT
CGTGGCTTCGTCGTCAGCAGCGAGGCCAAGACGGCTTTGGCTCTTCGCGCCCCGGCTGACGTGGTCAACCTGTTG
AGCGTCTGGGGGCTCGCCAACGAGAGGGGACTCGAGGGACTGCGCGCCATACCGAGGAGCGTCGTCGTCAACGAG
GCCATCAAGAGACGTGGCTTCCGCGGCGTCGTCGATGTCGTCCAAGTCGCCTCCCCCCGCCCAGAGGCTGCTGCC
GAGACGGTGTCGCCGCCGCCGCACGATGCCGTTACGAGCCAGAAACGGAAAAGCGCAGACGCGGGTCCGCACTCG
GCTGCCCAGCCTCTGAGCAAGCGGCAGGCCAAGAGGATGAAGTTGGCTGCTCGGGCGGCCGCGGTTGAAAAGGGG
CAGGCTGGAGCACCGTGA
Gene >Ophun1|1350
ATGTTGAGTGCTGATGCTCGTGGCCGCGCAAACTTCATCGGTAACCTTACAAGTCTTGTCCGCGCCACTCGCGGT
CGTGGCTTCGTCGTCAGCAGCGAGGCCAAGACGGCTTTGGCTCTTCGCGCCCCGGCTGACGTGGTCAACCTGTTG
AGCGTCTGGGGGCTCGCCAACGAGAGGGGACTCGAGGGACTGCGCGCCATACCGAGGAGCGTCGTCGTCAACGAG
GCCATCAAGAGACGTGGCTTCCGCGGCGTCGTCGATGTCGTCCAAGTCGCCTCCCCCCGCCCAGAGGCTGCTGCC
GAGACGGTGTCGCCGCCGCCGCACGATGCCGTTACGAGCCAGAAACGGAAAAGCGCAGACGCGGGTCCGCACTCG
GCTGCCCAGCCTCTGAGCAAGCGGCAGGCCAAGAGGATGAAGTTGGCTGCTCGGGCGGCCGCGGTTGAAAAGGGG
CAGGCTGGAGCACCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail