Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1349
Gene name
LocationContig_153:28787..32116
Strand+
Gene length (bp)3329
Transcript length (bp)2655
Coding sequence length (bp)2655
Protein length (aa) 885

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02586 SRAP SOS response associated peptidase (SRAP) 3.8E-73 658 884
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 6.3E-51 48 225
PF06421 LepA_C GTP-binding protein LepA C-terminus 2.7E-43 539 645
PF00679 EFG_C Elongation factor G C-terminus 7.1E-19 450 536
PF00071 Ras Ras family 1.4E-04 97 224
PF01926 MMR_HSR1 50S ribosome-binding GTPase 4.6E-05 53 161

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 629 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 30 646 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 30 646 0.0E+00
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 36 646 0.0E+00
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 36 646 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|C7ZA26|GUF1_NECH7 Translation factor GUF1, mitochondrial OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=GUF1 PE=3 SV=1 1 629 0.0E+00
sp|D1ZET3|GUF1_SORMK Translation factor GUF1, mitochondrial OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=GUF1 PE=3 SV=1 30 646 0.0E+00
sp|Q7S0P6|GUF1_NEUCR Translation factor guf1, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=guf1 PE=3 SV=2 30 646 0.0E+00
sp|C8VPJ1|GUF1_EMENI Translation factor guf1, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=guf1 PE=3 SV=1 36 646 0.0E+00
sp|C5JRK2|GUF1_AJEDS Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain SLH14081) GN=GUF1 PE=3 SV=1 36 646 0.0E+00
sp|C5GRI9|GUF1_AJEDR Translation factor GUF1, mitochondrial OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=GUF1 PE=3 SV=1 36 646 0.0E+00
sp|A4QV78|GUF1_MAGO7 Translation factor GUF1, mitochondrial OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=GUF1 PE=3 SV=2 36 646 0.0E+00
sp|C0NZL9|GUF1_AJECG Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=GUF1 PE=3 SV=1 16 646 0.0E+00
sp|C6HPI9|GUF1_AJECH Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain H143) GN=GUF1 PE=3 SV=2 16 646 0.0E+00
sp|A1CLD7|GUF1_ASPCL Translation factor guf1, mitochondrial OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=guf1 PE=3 SV=1 16 646 0.0E+00
sp|A6RGX9|GUF1_AJECN Translation factor GUF1, mitochondrial OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=GUF1 PE=3 SV=2 16 646 0.0E+00
sp|B8MS24|GUF1_TALSN Translation factor guf1, mitochondrial OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=guf1 PE=3 SV=1 24 646 0.0E+00
sp|A1D5Z0|GUF1_NEOFI Translation factor guf1, mitochondrial OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=guf1 PE=3 SV=1 19 646 0.0E+00
sp|B6QW35|GUF1_TALMQ Translation factor guf1, mitochondrial OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=guf1 PE=3 SV=1 12 646 0.0E+00
sp|A2QU25|GUF1_ASPNC Translation factor guf1, mitochondrial OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=guf1 PE=3 SV=1 34 646 0.0E+00
sp|Q2U3T4|GUF1_ASPOR Translation factor guf1, mitochondrial OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=guf1 PE=3 SV=1 26 646 0.0E+00
sp|Q0CS42|GUF1_ASPTN Translation factor guf1, mitochondrial OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=guf1 PE=3 SV=1 36 646 0.0E+00
sp|C1GX39|GUF1_PARBA Translation factor GUF1, mitochondrial OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=GUF1 PE=3 SV=2 1 646 0.0E+00
sp|C0SHD5|GUF1_PARBP Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb03) GN=GUF1 PE=3 SV=1 1 646 0.0E+00
sp|C4JWU3|GUF1_UNCRE Translation factor GUF1, mitochondrial OS=Uncinocarpus reesii (strain UAMH 1704) GN=GUF1 PE=3 SV=1 27 646 0.0E+00
sp|Q4WYV0|GUF1_ASPFU Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=guf1 PE=3 SV=2 36 646 0.0E+00
sp|B6H2S6|GUF1_PENRW Translation factor guf1, mitochondrial OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=guf1 PE=3 SV=1 36 646 0.0E+00
sp|B0XZZ2|GUF1_ASPFC Translation factor guf1, mitochondrial OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=guf1 PE=3 SV=2 36 646 0.0E+00
sp|C1GGI6|GUF1_PARBD Translation factor GUF1, mitochondrial OS=Paracoccidioides brasiliensis (strain Pb18) GN=GUF1 PE=3 SV=1 1 646 0.0E+00
sp|Q0V3J4|GUF1_PHANO Translation factor GUF1, mitochondrial OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=GUF1 PE=3 SV=2 24 646 0.0E+00
sp|C5PCH4|GUF1_COCP7 Translation factor GUF1, mitochondrial OS=Coccidioides posadasii (strain C735) GN=GUF1 PE=3 SV=1 27 646 0.0E+00
sp|C5FMX6|GUF1_ARTOC Translation factor GUF1, mitochondrial OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=GUF1 PE=3 SV=2 20 635 0.0E+00
sp|Q6BMV8|GUF1_DEBHA Translation factor GUF1, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GUF1 PE=3 SV=2 31 647 0.0E+00
sp|C5DWG7|GUF1_ZYGRC Translation factor GUF1, mitochondrial OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=GUF1 PE=3 SV=1 9 646 0.0E+00
sp|C5DN84|GUF1_LACTC Translation factor GUF1, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=GUF1 PE=3 SV=1 34 646 0.0E+00
sp|Q6FR62|GUF1_CANGA Translation factor GUF1, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GUF1 PE=3 SV=1 36 646 0.0E+00
sp|A5DG70|GUF1_PICGU Translation factor GUF1, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=GUF1 PE=3 SV=2 13 646 0.0E+00
sp|C4Y8M4|GUF1_CLAL4 Translation factor GUF1, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=GUF1 PE=3 SV=1 35 647 0.0E+00
sp|B9WBR8|GUF1_CANDC Translation factor GUF1, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=GUF1 PE=3 SV=1 35 646 0.0E+00
sp|Q74ZG2|GUF1_ASHGO Translation factor GUF1, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GUF1 PE=3 SV=1 9 646 0.0E+00
sp|Q59P53|GUF1_CANAL Translation factor GUF1, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GUF1 PE=3 SV=1 35 646 0.0E+00
sp|P46943|GUF1_YEAST Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GUF1 PE=1 SV=2 34 646 0.0E+00
sp|C8ZDQ3|GUF1_YEAS8 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=GUF1 PE=3 SV=1 34 646 0.0E+00
sp|A7A1H2|GUF1_YEAS7 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=GUF1 PE=3 SV=1 34 646 0.0E+00
sp|B3RHG9|GUF1_YEAS1 Translation factor GUF1, mitochondrial OS=Saccharomyces cerevisiae (strain RM11-1a) GN=GUF1 PE=3 SV=1 34 646 0.0E+00
sp|Q6CUH2|GUF1_KLULA Translation factor GUF1, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GUF1 PE=3 SV=1 37 646 0.0E+00
sp|C5M6K8|GUF1_CANTT Translation factor GUF1, mitochondrial OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=GUF1 PE=3 SV=1 35 646 0.0E+00
sp|C4YIT6|GUF1_CANAW Translation factor GUF1, mitochondrial OS=Candida albicans (strain WO-1) GN=GUF1 PE=3 SV=1 35 646 0.0E+00
sp|A5DWY7|GUF1_LODEL Translation factor GUF1, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=GUF1 PE=3 SV=1 35 646 0.0E+00
sp|Q6C255|GUF1_YARLI Translation factor GUF1, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GUF1 PE=3 SV=1 10 646 0.0E+00
sp|O13869|GUF1_SCHPO Translation factor guf1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=guf1 PE=3 SV=2 24 646 0.0E+00
sp|A7TPD4|GUF1_VANPO Translation factor GUF1, mitochondrial OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=GUF1 PE=3 SV=1 5 646 0.0E+00
sp|B6K6L6|GUF1_SCHJY Translation factor guf1, mitochondrial OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=guf1 PE=3 SV=1 36 647 0.0E+00
sp|Q8N442|GUF1_HUMAN Translation factor GUF1, mitochondrial OS=Homo sapiens GN=GUF1 PE=1 SV=1 23 648 0.0E+00
sp|Q8C3X4|GUF1_MOUSE Translation factor Guf1, mitochondrial OS=Mus musculus GN=Guf1 PE=1 SV=1 36 644 0.0E+00
sp|A6QLJ3|GUF1_BOVIN Translation factor GUF1, mitochondrial OS=Bos taurus GN=GUF1 PE=2 SV=1 4 648 0.0E+00
sp|A9S3D3|GUF1_PHYPA Translation factor GUF1 homolog, mitochondrial OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_180825 PE=3 SV=1 10 644 0.0E+00
sp|B9RUN8|GUF1_RICCO Translation factor GUF1 homolog, mitochondrial OS=Ricinus communis GN=RCOM_0855130 PE=3 SV=1 45 644 0.0E+00
sp|Q9FLE4|GUF1_ARATH Translation factor GUF1 homolog, mitochondrial OS=Arabidopsis thaliana GN=At5g39900 PE=2 SV=1 25 644 0.0E+00
sp|Q5VQ69|GUF1_ORYSJ Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. japonica GN=Os06g0144800 PE=3 SV=1 33 644 0.0E+00
sp|O67618|LEPA_AQUAE Elongation factor 4 OS=Aquifex aeolicus (strain VF5) GN=lepA PE=1 SV=1 50 644 0.0E+00
sp|C5Z3W1|GUF1_SORBI Translation factor GUF1 homolog, mitochondrial OS=Sorghum bicolor GN=Sb10g003070 PE=3 SV=1 45 644 0.0E+00
sp|B0CS18|GUF1_LACBS Translation factor GUF1, mitochondrial OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=GUF1 PE=3 SV=1 50 648 0.0E+00
sp|B8J444|LEPA_DESDA Elongation factor 4 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=lepA PE=3 SV=1 44 644 0.0E+00
sp|B3RXR7|GUF1_TRIAD Translation factor GUF1 homolog, mitochondrial OS=Trichoplax adhaerens GN=TRIADDRAFT_56304 PE=3 SV=1 27 646 0.0E+00
sp|A5G4G3|LEPA_GEOUR Elongation factor 4 OS=Geobacter uraniireducens (strain Rf4) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q2Y873|LEPA_NITMU Elongation factor 4 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q044A7|LEPA_LACGA Elongation factor 4 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=lepA PE=3 SV=1 50 654 0.0E+00
sp|A4J7F8|LEPA_DESRM Elongation factor 4 OS=Desulfotomaculum reducens (strain MI-1) GN=lepA PE=3 SV=1 45 645 0.0E+00
sp|Q67S76|LEPA_SYMTH Elongation factor 4 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=lepA PE=3 SV=1 50 645 0.0E+00
sp|B5EB36|LEPA_GEOBB Elongation factor 4 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|P60790|LEPA_LACJO Elongation factor 4 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=lepA PE=3 SV=1 50 654 0.0E+00
sp|Q30XI4|LEPA_DESAG Elongation factor 4 OS=Desulfovibrio alaskensis (strain G20) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q2JQ51|LEPA_SYNJB Elongation factor 4 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=lepA PE=3 SV=1 43 644 0.0E+00
sp|Q5FJP6|LEPA_LACAC Elongation factor 4 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=lepA PE=3 SV=1 50 654 0.0E+00
sp|C6DZ67|LEPA_GEOSM Elongation factor 4 OS=Geobacter sp. (strain M21) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q72E76|LEPA_DESVH Elongation factor 4 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q3AF13|LEPA_CARHZ Elongation factor 4 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|B3WEQ5|LEPA_LACCB Elongation factor 4 OS=Lactobacillus casei (strain BL23) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q038N6|LEPA_LACC3 Elongation factor 4 OS=Lactobacillus casei (strain ATCC 334) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B9M4U5|LEPA_GEODF Elongation factor 4 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|C6BST2|LEPA_DESAD Elongation factor 4 OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|B2G6W5|LEPA_LACRJ Elongation factor 4 OS=Lactobacillus reuteri (strain JCM 1112) GN=lepA PE=3 SV=1 35 651 0.0E+00
sp|A5VJE9|LEPA_LACRD Elongation factor 4 OS=Lactobacillus reuteri (strain DSM 20016) GN=lepA PE=3 SV=1 35 651 0.0E+00
sp|B0G189|GUF1_DICDI Translation factor GUF1 homolog, mitochondrial OS=Dictyostelium discoideum GN=guf1 PE=3 SV=1 24 651 0.0E+00
sp|Q2JWR1|LEPA_SYNJA Elongation factor 4 OS=Synechococcus sp. (strain JA-3-3Ab) GN=lepA PE=3 SV=1 44 644 0.0E+00
sp|P60789|LEPA_GEOSL Elongation factor 4 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B4U6M2|LEPA_HYDS0 Elongation factor 4 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|A7HCF3|LEPA_ANADF Elongation factor 4 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q24SR6|LEPA_DESHY Elongation factor 4 OS=Desulfitobacterium hafniense (strain Y51) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B8FUP2|LEPA_DESHD Elongation factor 4 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B4UDQ7|LEPA_ANASK Elongation factor 4 OS=Anaeromyxobacter sp. (strain K) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q2IIA6|LEPA_ANADE Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|A0L631|LEPA_MAGMM Elongation factor 4 OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q1D6M1|LEPA_MYXXD Elongation factor 4 OS=Myxococcus xanthus (strain DK 1622) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|A1ARG8|LEPA_PELPD Elongation factor 4 OS=Pelobacter propionicus (strain DSM 2379) GN=lepA PE=3 SV=1 48 644 0.0E+00
sp|Q1MQF3|LEPA_LAWIP Elongation factor 4 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|C1D7L2|LEPA_LARHH Elongation factor 4 OS=Laribacter hongkongensis (strain HLHK9) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|A6Q241|LEPA_NITSB Elongation factor 4 OS=Nitratiruptor sp. (strain SB155-2) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q049W8|LEPA_LACDB Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q1G9R4|LEPA_LACDA Elongation factor 4 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B8JAF3|LEPA_ANAD2 Elongation factor 4 OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B2GBR9|LEPA_LACF3 Elongation factor 4 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=lepA PE=3 SV=1 47 651 0.0E+00
sp|A8YVQ1|LEPA_LACH4 Elongation factor 4 OS=Lactobacillus helveticus (strain DPC 4571) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q88VN0|LEPA1_LACPL Elongation factor 4 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lepA1 PE=3 SV=1 47 644 0.0E+00
sp|C0M8H9|LEPA_STRE4 Elongation factor 4 OS=Streptococcus equi subsp. equi (strain 4047) GN=lepA PE=3 SV=1 34 645 0.0E+00
sp|C0MDV7|LEPA_STRS7 Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=lepA PE=3 SV=1 34 645 0.0E+00
sp|A6SXR0|LEPA_JANMA Elongation factor 4 OS=Janthinobacterium sp. (strain Marseille) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|A4S3R2|GUF1_OSTLU Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus lucimarinus (strain CCE9901) GN=OSTLU_88434 PE=3 SV=1 39 646 0.0E+00
sp|Q2RKX8|LEPA_MOOTA Elongation factor 4 OS=Moorella thermoacetica (strain ATCC 39073) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|A5D3X6|LEPA_PELTS Elongation factor 4 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|B7PJS6|GUF1_IXOSC Translation factor GUF1 homolog, mitochondrial OS=Ixodes scapularis GN=ISCW003920 PE=3 SV=1 24 647 0.0E+00
sp|B4U3G9|LEPA_STREM Elongation factor 4 OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=lepA PE=3 SV=1 34 645 0.0E+00
sp|B8DIZ5|LEPA_DESVM Elongation factor 4 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|B1XTL2|LEPA_POLNS Elongation factor 4 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q5YZZ7|LEPA_NOCFA Elongation factor 4 OS=Nocardia farcinica (strain IFM 10152) GN=lepA PE=3 SV=1 48 651 0.0E+00
sp|A7ZCJ3|LEPA_CAMC1 Elongation factor 4 OS=Campylobacter concisus (strain 13826) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B0TAD2|LEPA_HELMI Elongation factor 4 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=lepA PE=3 SV=1 50 645 0.0E+00
sp|Q0AF67|LEPA_NITEC Elongation factor 4 OS=Nitrosomonas eutropha (strain C91) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|B1IC02|LEPA_STRPI Elongation factor 4 OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|A8AWG3|LEPA_STRGC Elongation factor 4 OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|Q9KD76|LEPA_BACHD Elongation factor 4 OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=lepA PE=3 SV=1 48 644 0.0E+00
sp|A9GWZ4|LEPA_SORC5 Elongation factor 4 OS=Sorangium cellulosum (strain So ce56) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B3E9R0|LEPA_GEOLS Elongation factor 4 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=lepA PE=3 SV=1 48 644 0.0E+00
sp|Q8RB72|LEPA_CALS4 Elongation factor 4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|O51115|LEPA_BORBU Elongation factor 4 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=lepA PE=3 SV=2 48 644 0.0E+00
sp|Q39US7|LEPA_GEOMG Elongation factor 4 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=lepA PE=3 SV=2 47 644 0.0E+00
sp|P37949|LEPA_BACSU Elongation factor 4 OS=Bacillus subtilis (strain 168) GN=lepA PE=3 SV=2 38 644 0.0E+00
sp|B9DSE0|LEPA_STRU0 Elongation factor 4 OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=lepA PE=3 SV=1 34 645 0.0E+00
sp|C1C7G9|LEPA_STRP7 Elongation factor 4 OS=Streptococcus pneumoniae (strain 70585) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|B5E4T8|LEPA_STRP4 Elongation factor 4 OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|B0K3Y4|LEPA_THEPX Elongation factor 4 OS=Thermoanaerobacter sp. (strain X514) GN=lepA PE=3 SV=1 37 644 0.0E+00
sp|Q3A445|LEPA_PELCD Elongation factor 4 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=lepA PE=3 SV=1 48 644 0.0E+00
sp|B9MJZ5|LEPA_CALBD Elongation factor 4 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q03QU8|LEPA_LACBA Elongation factor 4 OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|B8B2R1|GUF1_ORYSI Translation factor GUF1 homolog, mitochondrial OS=Oryza sativa subsp. indica GN=OsI_21607 PE=3 SV=1 45 644 0.0E+00
sp|B7GKC4|LEPA_ANOFW Elongation factor 4 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=lepA PE=3 SV=1 38 644 0.0E+00
sp|A3DF29|LEPA_CLOTH Elongation factor 4 OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=lepA PE=3 SV=1 47 644 0.0E+00
sp|Q0IFX5|GUF1_AEDAE Translation factor GUF1 homolog, mitochondrial OS=Aedes aegypti GN=AAEL003926 PE=3 SV=1 38 646 0.0E+00
sp|Q38W39|LEPA_LACSS Elongation factor 4 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=lepA PE=3 SV=1 50 644 0.0E+00
sp|Q00ZZ1|GUF1_OSTTA Translation factor GUF1 homolog, mitochondrial OS=Ostreococcus tauri GN=Ot10g01840 PE=3 SV=1 39 645 0.0E+00
sp|Q662S4|LEPA_BORBP Elongation factor 4 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=lepA PE=3 SV=1 48 644 0.0E+00
sp|P65274|LEPA_STRA5 Elongation factor 4 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|P65273|LEPA_STRA3 Elongation factor 4 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|Q3K1F9|LEPA_STRA1 Elongation factor 4 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|C1CKU6|LEPA_STRZP Elongation factor 4 OS=Streptococcus pneumoniae (strain P1031) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|Q97QK5|LEPA_STRPN Elongation factor 4 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=lepA PE=3 SV=1 47 645 0.0E+00
sp|B0KA85|LEPA_THEP3 Elongation factor 4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=lepA PE=3 SV=1 37 644 0.0E+00
sp|C1CR98|LEPA_STRZT Elongation factor 4 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=lepA PE=3 SV=1 48 645 1.0E-180
sp|Q8DPN5|LEPA_STRR6 Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=lepA PE=3 SV=1 48 645 1.0E-180
sp|B8ZQ69|LEPA_STRPJ Elongation factor 4 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=lepA PE=3 SV=1 48 645 1.0E-180
sp|Q04KB7|LEPA_STRP2 Elongation factor 4 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=lepA PE=3 SV=1 48 645 1.0E-180
sp|Q7NAT2|LEPA_MYCGA Elongation factor 4 OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lepA PE=3 SV=2 50 644 1.0E-180
sp|A4IR35|LEPA_GEOTN Elongation factor 4 OS=Geobacillus thermodenitrificans (strain NG80-2) GN=lepA PE=3 SV=1 38 644 2.0E-180
sp|A9M3J8|LEPA_NEIM0 Elongation factor 4 OS=Neisseria meningitidis serogroup C (strain 053442) GN=lepA PE=3 SV=1 50 644 2.0E-180
sp|Q5WHG5|LEPA_BACSK Elongation factor 4 OS=Bacillus clausii (strain KSM-K16) GN=lepA PE=3 SV=1 48 644 2.0E-180
sp|Q0SP76|LEPA_BORAP Elongation factor 4 OS=Borrelia afzelii (strain PKo) GN=lepA PE=3 SV=1 48 644 2.0E-180
sp|Q13VM6|LEPA_BURXL Elongation factor 4 OS=Burkholderia xenovorans (strain LB400) GN=lepA PE=3 SV=1 50 644 3.0E-180
sp|Q5KWZ3|LEPA_GEOKA Elongation factor 4 OS=Geobacillus kaustophilus (strain HTA426) GN=lepA PE=3 SV=1 38 644 3.0E-180
sp|Q01SV7|LEPA_SOLUE Elongation factor 4 OS=Solibacter usitatus (strain Ellin6076) GN=lepA PE=3 SV=1 47 651 3.0E-180
sp|B4RK41|LEPA_NEIG2 Elongation factor 4 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=lepA PE=3 SV=1 50 644 3.0E-180
sp|Q5F9P9|LEPA_NEIG1 Elongation factor 4 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=lepA PE=3 SV=1 50 644 3.0E-180
sp|Q1JH37|LEPA_STRPD Elongation factor 4 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=lepA PE=3 SV=1 34 645 3.0E-180
sp|Q47EG0|LEPA_DECAR Elongation factor 4 OS=Dechloromonas aromatica (strain RCB) GN=lepA PE=3 SV=1 50 644 4.0E-180
sp|Q5M4M2|LEPA_STRT2 Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=lepA PE=3 SV=1 35 645 4.0E-180
sp|A1KT27|LEPA_NEIMF Elongation factor 4 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=lepA PE=3 SV=1 50 644 4.0E-180
sp|Q9K055|LEPA_NEIMB Elongation factor 4 OS=Neisseria meningitidis serogroup B (strain MC58) GN=lepA PE=3 SV=1 50 644 5.0E-180
sp|Q89BJ8|LEPA_BRADU Elongation factor 4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=lepA PE=3 SV=2 41 644 5.0E-180
sp|C1CEG3|LEPA_STRZJ Elongation factor 4 OS=Streptococcus pneumoniae (strain JJA) GN=lepA PE=3 SV=1 48 645 7.0E-180
sp|Q9JV65|LEPA_NEIMA Elongation factor 4 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=lepA PE=3 SV=1 50 644 7.0E-180
sp|P0DC23|LEPA_STRPQ Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=lepA PE=3 SV=1 34 645 8.0E-180
sp|P0DC22|LEPA_STRP3 Elongation factor 4 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=lepA PE=3 SV=1 34 645 8.0E-180
sp|A7GZW3|LEPA_CAMC5 Elongation factor 4 OS=Campylobacter curvus (strain 525.92) GN=lepA PE=3 SV=1 50 644 8.0E-180
sp|A7Z6W5|LEPA_BACMF Elongation factor 4 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=lepA PE=3 SV=1 38 644 1.0E-179
sp|Q48TU0|LEPA_STRPM Elongation factor 4 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=lepA PE=3 SV=1 34 645 1.0E-179
sp|Q1JLY8|LEPA_STRPC Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=lepA PE=3 SV=1 34 645 1.0E-179
sp|Q6KHP1|LEPA_MYCMO Elongation factor 4 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=lepA PE=3 SV=1 48 644 1.0E-179
sp|Q8EWZ9|LEPA_MYCPE Elongation factor 4 OS=Mycoplasma penetrans (strain HF-2) GN=lepA PE=3 SV=1 50 646 1.0E-179
sp|Q99ZV8|LEPA_STRP1 Elongation factor 4 OS=Streptococcus pyogenes serotype M1 GN=lepA PE=3 SV=1 34 645 1.0E-179
sp|Q1B684|LEPA_MYCSS Elongation factor 4 OS=Mycobacterium sp. (strain MCS) GN=lepA PE=3 SV=1 50 651 2.0E-179
sp|A1UIU2|LEPA_MYCSK Elongation factor 4 OS=Mycobacterium sp. (strain KMS) GN=lepA PE=3 SV=1 50 651 2.0E-179
sp|A3Q2A6|LEPA_MYCSJ Elongation factor 4 OS=Mycobacterium sp. (strain JLS) GN=lepA PE=3 SV=1 50 651 2.0E-179
sp|Q03KW7|LEPA_STRTD Elongation factor 4 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=lepA PE=3 SV=1 35 645 2.0E-179
sp|Q5M008|LEPA_STRT1 Elongation factor 4 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=lepA PE=3 SV=1 35 645 2.0E-179
sp|Q831Z0|LEPA_ENTFA Elongation factor 4 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=lepA PE=3 SV=1 34 644 2.0E-179
sp|Q5XCD2|LEPA_STRP6 Elongation factor 4 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=lepA PE=3 SV=1 34 645 2.0E-179
sp|A9KKU4|LEPA_CLOPH Elongation factor 4 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=lepA PE=3 SV=1 41 644 2.0E-179
sp|A2RL76|LEPA_LACLM Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=lepA PE=3 SV=1 47 645 2.0E-179
sp|Q9CGI8|LEPA_LACLA Elongation factor 4 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=lepA PE=3 SV=1 47 645 3.0E-179
sp|P53530|LEPA_MYCLE Elongation factor 4 OS=Mycobacterium leprae (strain TN) GN=lepA PE=3 SV=1 1 651 3.0E-179
sp|B8ZUS2|LEPA_MYCLB Elongation factor 4 OS=Mycobacterium leprae (strain Br4923) GN=lepA PE=3 SV=1 1 651 3.0E-179
sp|Q02Z80|LEPA_LACLS Elongation factor 4 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=lepA PE=3 SV=1 47 645 3.0E-179
sp|Q8RFD1|LEPA_FUSNN Elongation factor 4 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=lepA PE=3 SV=1 41 644 4.0E-179
sp|Q1JC06|LEPA_STRPB Elongation factor 4 OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=lepA PE=3 SV=1 34 645 4.0E-179
sp|B7KJX0|LEPA_CYAP7 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7424) GN=lepA PE=3 SV=1 44 644 6.0E-179
sp|A5FLU8|LEPA_FLAJ1 Elongation factor 4 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=lepA PE=3 SV=1 47 644 6.0E-179
sp|B1KZP1|LEPA_CLOBM Elongation factor 4 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=lepA PE=3 SV=1 50 644 7.0E-179
sp|B2SZV7|LEPA_BURPP Elongation factor 4 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lepA PE=3 SV=1 50 644 7.0E-179
sp|B5XLC6|LEPA_STRPZ Elongation factor 4 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=lepA PE=3 SV=1 34 645 7.0E-179
sp|B8DUL6|LEPA_BIFA0 Elongation factor 4 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=lepA PE=3 SV=1 50 660 9.0E-179
sp|Q39I75|LEPA_BURL3 Elongation factor 4 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=lepA PE=3 SV=1 50 644 1.0E-178
sp|Q0SH84|LEPA_RHOJR Elongation factor 4 OS=Rhodococcus jostii (strain RHA1) GN=lepA PE=3 SV=1 48 648 1.0E-178
sp|B8I3E6|LEPA_CLOCE Elongation factor 4 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=lepA PE=3 SV=1 44 644 1.0E-178
sp|A4VUL8|LEPA_STRSY Elongation factor 4 OS=Streptococcus suis (strain 05ZYH33) GN=lepA PE=3 SV=1 47 645 1.0E-178
sp|A4W0W0|LEPA_STRS2 Elongation factor 4 OS=Streptococcus suis (strain 98HAH33) GN=lepA PE=3 SV=1 47 645 1.0E-178
sp|Q0RP81|LEPA_FRAAA Elongation factor 4 OS=Frankia alni (strain ACN14a) GN=lepA PE=3 SV=1 50 649 1.0E-178
sp|Q730L6|LEPA_BACC1 Elongation factor 4 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=lepA PE=3 SV=1 48 644 1.0E-178
sp|A6WDJ3|LEPA_KINRD Elongation factor 4 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=lepA PE=3 SV=1 47 645 1.0E-178
sp|A0Q1R8|LEPA_CLONN Elongation factor 4 OS=Clostridium novyi (strain NT) GN=lepA PE=3 SV=1 50 644 1.0E-178
sp|Q1WUE6|LEPA_LACS1 Elongation factor 4 OS=Lactobacillus salivarius (strain UCC118) GN=lepA PE=3 SV=1 50 644 1.0E-178
sp|B3R202|LEPA_CUPTR Elongation factor 4 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lepA PE=3 SV=1 47 644 1.0E-178
sp|A8FFD6|LEPA_BACP2 Elongation factor 4 OS=Bacillus pumilus (strain SAFR-032) GN=lepA PE=3 SV=1 38 644 2.0E-178
sp|A4XKA0|LEPA_CALS8 Elongation factor 4 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=lepA PE=3 SV=1 47 644 2.0E-178
sp|B0JQT7|LEPA_MICAN Elongation factor 4 OS=Microcystis aeruginosa (strain NIES-843) GN=lepA PE=3 SV=1 44 644 2.0E-178
sp|Q8DTF3|LEPA_STRMU Elongation factor 4 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=lepA PE=3 SV=1 47 645 2.0E-178
sp|A0RQX4|LEPA_CAMFF Elongation factor 4 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=lepA PE=3 SV=1 50 644 3.0E-178
sp|Q5HBH4|LEPA_EHRRW Elongation factor 4 OS=Ehrlichia ruminantium (strain Welgevonden) GN=lepA PE=3 SV=1 50 640 3.0E-178
sp|Q11UD0|LEPA_CYTH3 Elongation factor 4 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=lepA PE=3 SV=1 47 644 3.0E-178
sp|Q0K8N0|LEPA_CUPNH Elongation factor 4 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lepA PE=3 SV=1 47 644 3.0E-178
sp|A5B4D2|GUFP_VITVI Translation factor GUF1 homolog, chloroplastic OS=Vitis vinifera GN=VITISV_013255 PE=3 SV=1 38 644 3.0E-178
sp|A5I644|LEPA_CLOBH Elongation factor 4 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=lepA PE=3 SV=1 50 644 3.0E-178
sp|A7FXL9|LEPA_CLOB1 Elongation factor 4 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=lepA PE=3 SV=1 50 644 3.0E-178
sp|C1F2I3|LEPA_ACIC5 Elongation factor 4 OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=lepA PE=3 SV=1 50 644 3.0E-178
sp|Q5FHQ1|LEPA_EHRRG Elongation factor 4 OS=Ehrlichia ruminantium (strain Gardel) GN=lepA PE=3 SV=1 50 640 4.0E-178
sp|P9WK97|LEPA_MYCTU Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lepA PE=1 SV=1 50 651 4.0E-178
sp|P9WK96|LEPA_MYCTO Elongation factor 4 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lepA PE=3 SV=1 50 651 4.0E-178
sp|A5U598|LEPA_MYCTA Elongation factor 4 OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=lepA PE=3 SV=1 50 651 4.0E-178
sp|C1AQW9|LEPA_MYCBT Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=lepA PE=3 SV=1 50 651 4.0E-178
sp|A1KL96|LEPA_MYCBP Elongation factor 4 OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=lepA PE=3 SV=1 50 651 4.0E-178
sp|P65270|LEPA_MYCBO Elongation factor 4 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=lepA PE=3 SV=1 50 651 4.0E-178
sp|C1AUN7|LEPA_RHOOB Elongation factor 4 OS=Rhodococcus opacus (strain B4) GN=lepA PE=3 SV=1 48 648 4.0E-178
sp|A7GHI0|LEPA_CLOBL Elongation factor 4 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=lepA PE=3 SV=1 50 644 5.0E-178
sp|B1ILM7|LEPA_CLOBK Elongation factor 4 OS=Clostridium botulinum (strain Okra / Type B1) GN=lepA PE=3 SV=1 50 644 5.0E-178
sp|B9E6X5|LEPA_MACCJ Elongation factor 4 OS=Macrococcus caseolyticus (strain JCSC5402) GN=lepA PE=3 SV=1 47 644 5.0E-178
sp|Q1QR19|LEPA_NITHX Elongation factor 4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=lepA PE=3 SV=1 34 644 5.0E-178
sp|C1FVU4|LEPA_CLOBJ Elongation factor 4 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=lepA PE=3 SV=1 50 644 5.0E-178
sp|B3ESU2|LEPA_AMOA5 Elongation factor 4 OS=Amoebophilus asiaticus (strain 5a2) GN=lepA PE=3 SV=1 50 644 6.0E-178
sp|Q1H2L5|LEPA_METFK Elongation factor 4 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=lepA1 PE=3 SV=1 50 644 7.0E-178
sp|A9III9|LEPA_BORPD Elongation factor 4 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lepA PE=3 SV=1 47 644 8.0E-178
sp|B0C9R9|LEPA_ACAM1 Elongation factor 4 OS=Acaryochloris marina (strain MBIC 11017) GN=lepA PE=3 SV=1 44 644 9.0E-178
sp|Q81LR7|LEPA_BACAN Elongation factor 4 OS=Bacillus anthracis GN=lepA PE=3 SV=1 48 644 1.0E-177
sp|C3P8M5|LEPA_BACAA Elongation factor 4 OS=Bacillus anthracis (strain A0248) GN=lepA PE=3 SV=1 48 644 1.0E-177
sp|C3L5S2|LEPA_BACAC Elongation factor 4 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=lepA PE=3 SV=1 48 644 1.0E-177
sp|A6H1S4|LEPA_FLAPJ Elongation factor 4 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=lepA PE=3 SV=1 50 644 1.0E-177
sp|A7GT14|LEPA_BACCN Elongation factor 4 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=lepA PE=3 SV=1 48 644 1.0E-177
sp|Q65H50|LEPA_BACLD Elongation factor 4 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=lepA PE=3 SV=1 48 657 1.0E-177
sp|B0S1G2|LEPA_FINM2 Elongation factor 4 OS=Finegoldia magna (strain ATCC 29328) GN=lepA PE=3 SV=1 50 644 1.0E-177
sp|Q8GCP5|LEPA_MYCFP Elongation factor 4 OS=Mycoplasma fermentans (strain ATCC 19989 / NBRC 14854 / NCTC 10117 / PG18) GN=lepA PE=3 SV=1 48 644 1.0E-177
sp|P56865|LEPA_BORPE Elongation factor 4 OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lepA PE=3 SV=2 47 644 1.0E-177
sp|B7HPL8|LEPA_BACC7 Elongation factor 4 OS=Bacillus cereus (strain AH187) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|B7JNV1|LEPA_BACC0 Elongation factor 4 OS=Bacillus cereus (strain AH820) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|B8HLK8|LEPA_CYAP4 Elongation factor 4 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=lepA PE=3 SV=1 45 644 2.0E-177
sp|Q6HDK2|LEPA_BACHK Elongation factor 4 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|Q634M2|LEPA_BACCZ Elongation factor 4 OS=Bacillus cereus (strain ZK / E33L) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|C1ESL3|LEPA_BACC3 Elongation factor 4 OS=Bacillus cereus (strain 03BB102) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|A0RIT7|LEPA_BACAH Elongation factor 4 OS=Bacillus thuringiensis (strain Al Hakam) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|Q820H8|LEPA_NITEU Elongation factor 4 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lepA PE=3 SV=1 47 644 2.0E-177
sp|Q7W5J4|LEPA_BORPA Elongation factor 4 OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lepA PE=3 SV=1 47 644 2.0E-177
sp|Q7WD30|LEPA_BORBR Elongation factor 4 OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lepA PE=3 SV=1 47 644 2.0E-177
sp|Q3SH47|LEPA_THIDA Elongation factor 4 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=lepA PE=3 SV=1 50 644 2.0E-177
sp|B7HCU5|LEPA_BACC4 Elongation factor 4 OS=Bacillus cereus (strain B4264) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|B7IYH2|LEPA_BACC2 Elongation factor 4 OS=Bacillus cereus (strain G9842) GN=lepA PE=3 SV=1 48 644 2.0E-177
sp|Q8DM20|LEPA_THEEB Elongation factor 4 OS=Thermosynechococcus elongatus (strain BP-1) GN=lepA PE=3 SV=1 44 644 2.0E-177
sp|B4SBG4|LEPA_PELPB Elongation factor 4 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=lepA PE=3 SV=1 41 645 3.0E-177
sp|B3QPU3|LEPA_CHLP8 Elongation factor 4 OS=Chlorobaculum parvum (strain NCIB 8327) GN=lepA PE=3 SV=1 50 645 3.0E-177
sp|A6LC18|LEPA_PARD8 Elongation factor 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=lepA PE=3 SV=1 50 644 4.0E-177
sp|Q2JDK2|LEPA_FRASC Elongation factor 4 OS=Frankia sp. (strain CcI3) GN=lepA PE=3 SV=2 50 649 4.0E-177
sp|Q97JJ6|LEPA_CLOAB Elongation factor 4 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=lepA PE=3 SV=1 50 644 4.0E-177
sp|A9RFQ5|GUFP_PHYPA Translation factor GUF1 homolog, chloroplastic OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_158777 PE=3 SV=1 38 644 4.0E-177
sp|Q49Y26|LEPA_STAS1 Elongation factor 4 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=lepA PE=3 SV=1 50 644 5.0E-177
sp|C3L3H1|LEPA_CLOB6 Elongation factor 4 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=lepA PE=3 SV=1 50 644 6.0E-177
sp|B9IY86|LEPA_BACCQ Elongation factor 4 OS=Bacillus cereus (strain Q1) GN=lepA PE=3 SV=1 48 644 8.0E-177
sp|Q9X1V8|LEPA_THEMA Elongation factor 4 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lepA PE=3 SV=1 50 651 1.0E-176
sp|A4JCQ9|LEPA_BURVG Elongation factor 4 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=lepA PE=3 SV=1 50 644 1.0E-176
sp|Q7VJZ1|LEPA_HELHP Elongation factor 4 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=lepA PE=3 SV=1 44 644 1.0E-176
sp|Q1IV51|LEPA_KORVE Elongation factor 4 OS=Koribacter versatilis (strain Ellin345) GN=lepA PE=3 SV=1 50 644 1.0E-176
sp|Q0A8Z4|LEPA_ALKEH Elongation factor 4 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=lepA PE=3 SV=1 48 644 2.0E-176
sp|Q818E4|LEPA_BACCR Elongation factor 4 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=lepA PE=3 SV=1 48 644 2.0E-176
sp|Q98QW3|LEPA_MYCPU Elongation factor 4 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=lepA PE=3 SV=2 48 644 2.0E-176
sp|Q3SVT1|LEPA_NITWN Elongation factor 4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=lepA PE=3 SV=1 45 644 3.0E-176
sp|B9RHQ5|GUFP_RICCO Translation factor GUF1 homolog, chloroplastic OS=Ricinus communis GN=RCOM_1767360 PE=3 SV=1 23 644 3.0E-176
sp|B1VGK6|LEPA_CORU7 Elongation factor 4 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=lepA PE=3 SV=1 47 645 3.0E-176
sp|Q8Y742|LEPA_LISMO Elongation factor 4 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lepA PE=3 SV=1 47 644 3.0E-176
sp|B8DE32|LEPA_LISMH Elongation factor 4 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=lepA PE=3 SV=1 47 644 3.0E-176
sp|Q71ZJ1|LEPA_LISMF Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lepA PE=3 SV=1 47 644 3.0E-176
sp|C1KVC6|LEPA_LISMC Elongation factor 4 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=lepA PE=3 SV=1 47 644 3.0E-176
sp|A9ADE0|LEPA_BURM1 Elongation factor 4 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=lepA PE=3 SV=1 50 644 3.0E-176
sp|A6L744|LEPA_BACV8 Elongation factor 4 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=lepA PE=3 SV=1 50 644 3.0E-176
sp|Q82BZ3|LEPA_STRAW Elongation factor 4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=lepA PE=3 SV=1 50 645 4.0E-176
sp|Q46Z15|LEPA_CUPPJ Elongation factor 4 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lepA PE=3 SV=1 47 644 4.0E-176
sp|Q8CXD0|LEPA_OCEIH Elongation factor 4 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lepA PE=3 SV=1 50 644 5.0E-176
sp|A0K5V7|LEPA_BURCH Elongation factor 4 OS=Burkholderia cenocepacia (strain HI2424) GN=lepA PE=3 SV=1 50 644 5.0E-176
sp|B1JYB1|LEPA_BURCC Elongation factor 4 OS=Burkholderia cenocepacia (strain MC0-3) GN=lepA PE=3 SV=1 50 644 5.0E-176
sp|Q1BXU3|LEPA_BURCA Elongation factor 4 OS=Burkholderia cenocepacia (strain AU 1054) GN=lepA PE=3 SV=1 50 644 5.0E-176
sp|A1BHJ8|LEPA_CHLPD Elongation factor 4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=lepA PE=3 SV=1 45 645 5.0E-176
sp|A9VHU6|LEPA_BACWK Elongation factor 4 OS=Bacillus weihenstephanensis (strain KBAB4) GN=lepA PE=3 SV=1 48 644 6.0E-176
sp|B0WXB8|GUF1_CULQU Translation factor GUF1 homolog, mitochondrial OS=Culex quinquefasciatus GN=CPIJ012086 PE=3 SV=1 42 646 7.0E-176
sp|Q9ZHZ8|LEPA_MYCH2 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 232) GN=lepA PE=3 SV=3 46 644 7.0E-176
sp|Q6F0Z2|LEPA_MESFL Elongation factor 4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=lepA PE=3 SV=1 48 644 8.0E-176
sp|Q4AAQ8|LEPA_MYCHJ Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=lepA PE=3 SV=1 46 644 9.0E-176
sp|Q3J8D2|LEPA_NITOC Elongation factor 4 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=lepA PE=3 SV=1 50 644 9.0E-176
sp|Q47RQ0|LEPA_THEFY Elongation factor 4 OS=Thermobifida fusca (strain YX) GN=lepA PE=3 SV=1 50 648 1.0E-175
sp|Q0BH06|LEPA_BURCM Elongation factor 4 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=lepA PE=3 SV=1 50 644 1.0E-175
sp|B1YVM2|LEPA_BURA4 Elongation factor 4 OS=Burkholderia ambifaria (strain MC40-6) GN=lepA PE=3 SV=1 50 644 1.0E-175
sp|B2JFK0|LEPA_BURP8 Elongation factor 4 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lepA PE=3 SV=1 50 644 1.0E-175
sp|Q2KWY3|LEPA_BORA1 Elongation factor 4 OS=Bordetella avium (strain 197N) GN=lepA PE=3 SV=1 47 644 1.0E-175
sp|A5IYS0|LEPA_MYCAP Elongation factor 4 OS=Mycoplasma agalactiae (strain PG2) GN=lepA PE=3 SV=1 48 644 1.0E-175
sp|P60794|LEPA_TREDE Elongation factor 4 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=lepA PE=3 SV=1 47 644 1.0E-175
sp|Q7M8H5|LEPA_WOLSU Elongation factor 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=lepA PE=3 SV=1 50 644 1.0E-175
sp|A0AIS8|LEPA_LISW6 Elongation factor 4 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lepA PE=3 SV=1 47 644 1.0E-175
sp|Q92BN4|LEPA_LISIN Elongation factor 4 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lepA PE=3 SV=1 47 644 2.0E-175
sp|Q0AWL9|LEPA_SYNWW Elongation factor 4 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=lepA PE=3 SV=1 50 644 2.0E-175
sp|Q7V8S4|LEPA_PROMM Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9313) GN=lepA PE=3 SV=1 44 644 2.0E-175
sp|D2VRR7|GUF1_NAEGR Translation factor GUF1 homolog, mitochondrial OS=Naegleria gruberi GN=NAEGRDRAFT_71680 PE=3 SV=1 47 647 2.0E-175
sp|C5CCD4|LEPA_MICLC Elongation factor 4 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=lepA PE=3 SV=1 50 651 2.0E-175
sp|Q98DV1|LEPA_RHILO Elongation factor 4 OS=Rhizobium loti (strain MAFF303099) GN=lepA PE=3 SV=1 43 640 2.0E-175
sp|Q7NWC7|LEPA_CHRVO Elongation factor 4 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=lepA PE=3 SV=1 50 644 2.0E-175
sp|Q4A8T9|LEPA_MYCH7 Elongation factor 4 OS=Mycoplasma hyopneumoniae (strain 7448) GN=lepA PE=3 SV=1 46 644 2.0E-175
sp|P60930|LEPA_BDEBA Elongation factor 4 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=lepA PE=3 SV=2 50 644 2.0E-175
sp|A4SFN5|LEPA_CHLPM Elongation factor 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=lepA PE=3 SV=1 48 645 2.0E-175
sp|A4Y4K2|LEPA_SHEPC Elongation factor 4 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=lepA PE=3 SV=1 50 644 3.0E-175
sp|P60791|LEPA_MYCPA Elongation factor 4 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=lepA PE=3 SV=1 50 651 3.0E-175
sp|Q4L6T4|LEPA_STAHJ Elongation factor 4 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=lepA PE=3 SV=1 47 644 3.0E-175
sp|A4SVW0|LEPA_POLSQ Elongation factor 4 OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=lepA PE=3 SV=1 50 644 4.0E-175
sp|Q2SXT6|LEPA_BURTA Elongation factor 4 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lepA PE=3 SV=1 50 644 4.0E-175
sp|C1DQS0|LEPA_AZOVD Elongation factor 4 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=lepA PE=3 SV=1 50 644 4.0E-175
sp|Q3ATB2|LEPA_CHLCH Elongation factor 4 OS=Chlorobium chlorochromatii (strain CaD3) GN=lepA PE=3 SV=1 48 645 5.0E-175
sp|Q6A9B2|LEPA_PROAC Elongation factor 4 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=lepA PE=3 SV=1 50 644 5.0E-175
sp|A8LR11|LEPA_DINSH Elongation factor 4 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=lepA PE=3 SV=1 48 644 6.0E-175
sp|Q1LKM8|LEPA_CUPMC Elongation factor 4 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=lepA PE=3 SV=1 50 644 7.0E-175
sp|B1XK44|LEPA_SYNP2 Elongation factor 4 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=lepA PE=3 SV=1 44 644 8.0E-175
sp|B3PLU0|LEPA_MYCA5 Elongation factor 4 OS=Mycoplasma arthritidis (strain 158L3-1) GN=lepA PE=3 SV=1 44 644 9.0E-175
sp|A1RMC9|LEPA_SHESW Elongation factor 4 OS=Shewanella sp. (strain W3-18-1) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|Q63S94|LEPA_BURPS Elongation factor 4 OS=Burkholderia pseudomallei (strain K96243) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|A3NBT1|LEPA_BURP6 Elongation factor 4 OS=Burkholderia pseudomallei (strain 668) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|Q3JQ75|LEPA_BURP1 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1710b) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|A3NXL8|LEPA_BURP0 Elongation factor 4 OS=Burkholderia pseudomallei (strain 1106a) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|A1V6B9|LEPA_BURMS Elongation factor 4 OS=Burkholderia mallei (strain SAVP1) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|Q62LT1|LEPA_BURMA Elongation factor 4 OS=Burkholderia mallei (strain ATCC 23344) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|A2S9Z3|LEPA_BURM9 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10229) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|A3MM44|LEPA_BURM7 Elongation factor 4 OS=Burkholderia mallei (strain NCTC 10247) GN=lepA PE=3 SV=1 50 644 9.0E-175
sp|B1KI55|LEPA_SHEWM Elongation factor 4 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=lepA PE=3 SV=1 50 644 1.0E-174
sp|B9DNK4|LEPA_STACT Elongation factor 4 OS=Staphylococcus carnosus (strain TM300) GN=lepA PE=3 SV=1 38 644 2.0E-174
sp|Q5ZUD2|LEPA_LEGPH Elongation factor 4 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lepA PE=3 SV=1 48 642 2.0E-174
sp|A5ID24|LEPA_LEGPC Elongation factor 4 OS=Legionella pneumophila (strain Corby) GN=lepA PE=3 SV=1 48 642 2.0E-174
sp|Q5X443|LEPA_LEGPA Elongation factor 4 OS=Legionella pneumophila (strain Paris) GN=lepA PE=3 SV=1 48 642 2.0E-174
sp|Q8AA33|LEPA_BACTN Elongation factor 4 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=lepA PE=3 SV=1 50 644 2.0E-174
sp|Q1CUF5|LEPA_HELPH Elongation factor 4 OS=Helicobacter pylori (strain HPAG1) GN=lepA PE=3 SV=1 45 644 2.0E-174
sp|Q5WVI1|LEPA_LEGPL Elongation factor 4 OS=Legionella pneumophila (strain Lens) GN=lepA PE=3 SV=1 48 642 2.0E-174
sp|B6JKS8|LEPA_HELP2 Elongation factor 4 OS=Helicobacter pylori (strain P12) GN=lepA PE=3 SV=1 45 644 3.0E-174
sp|B1VY28|LEPA_STRGG Elongation factor 4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lepA PE=3 SV=1 50 645 3.0E-174
sp|B2USI5|LEPA_HELPS Elongation factor 4 OS=Helicobacter pylori (strain Shi470) GN=lepA PE=3 SV=1 44 644 3.0E-174
sp|Q2GD00|LEPA_NEOSM Elongation factor 4 OS=Neorickettsia sennetsu (strain Miyayama) GN=lepA PE=3 SV=1 50 644 3.0E-174
sp|Q21IH3|LEPA_SACD2 Elongation factor 4 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=lepA PE=3 SV=1 50 644 4.0E-174
sp|B2RKK1|LEPA_PORG3 Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=lepA PE=3 SV=1 50 644 4.0E-174
sp|B1I6E0|LEPA_DESAP Elongation factor 4 OS=Desulforudis audaxviator (strain MP104C) GN=lepA PE=3 SV=1 44 645 5.0E-174
sp|Q8KCH0|LEPA_CHLTE Elongation factor 4 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=lepA PE=3 SV=1 50 645 5.0E-174
sp|Q5PAX8|LEPA_ANAMM Elongation factor 4 OS=Anaplasma marginale (strain St. Maries) GN=lepA PE=3 SV=1 50 640 5.0E-174
sp|B9KIE5|LEPA_ANAMF Elongation factor 4 OS=Anaplasma marginale (strain Florida) GN=lepA PE=3 SV=1 50 640 5.0E-174
sp|A4G6S1|LEPA_HERAR Elongation factor 4 OS=Herminiimonas arsenicoxydans GN=lepA PE=3 SV=1 50 644 5.0E-174
sp|Q3B2V1|LEPA_CHLL7 Elongation factor 4 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=lepA PE=3 SV=1 48 645 5.0E-174
sp|Q16BA3|LEPA_ROSDO Elongation factor 4 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=lepA PE=3 SV=1 45 644 8.0E-174
sp|C3PHY1|LEPA_CORA7 Elongation factor 4 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=lepA PE=3 SV=1 48 645 8.0E-174
sp|B3EPG7|LEPA_CHLPB Elongation factor 4 OS=Chlorobium phaeobacteroides (strain BS1) GN=lepA PE=3 SV=1 50 645 8.0E-174
sp|B3CPV1|LEPA_WOLPP Elongation factor 4 OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=lepA PE=3 SV=1 50 640 9.0E-174
sp|Q7MV56|LEPA_PORGI Elongation factor 4 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=lepA PE=3 SV=1 50 644 9.0E-174
sp|A8MFA6|LEPA_ALKOO Elongation factor 4 OS=Alkaliphilus oremlandii (strain OhILAs) GN=lepA PE=3 SV=1 44 644 1.0E-173
sp|O25122|LEPA_HELPY Elongation factor 4 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=lepA PE=3 SV=1 45 644 1.0E-173
sp|Q2GGA6|LEPA_EHRCR Elongation factor 4 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=lepA PE=3 SV=1 50 640 1.0E-173
sp|Q4JWS1|LEPA_CORJK Elongation factor 4 OS=Corynebacterium jeikeium (strain K411) GN=lepA PE=3 SV=1 47 645 2.0E-173
sp|B1WWD8|LEPA_CYAA5 Elongation factor 4 OS=Cyanothece sp. (strain ATCC 51142) GN=lepA PE=3 SV=1 44 644 2.0E-173
sp|A8FSD4|LEPA_SHESH Elongation factor 4 OS=Shewanella sediminis (strain HAW-EB3) GN=lepA PE=3 SV=1 50 644 2.0E-173
sp|Q9ZM93|LEPA_HELPJ Elongation factor 4 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=lepA PE=3 SV=1 45 644 2.0E-173
sp|B9KNH9|LEPA_RHOSK Elongation factor 4 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=lepA PE=3 SV=1 50 648 2.0E-173
sp|B5ZBD4|LEPA_UREU1 Elongation factor 4 OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=lepA PE=3 SV=1 50 646 2.0E-173
sp|Q3J4P0|LEPA_RHOS4 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=lepA PE=3 SV=2 50 648 2.0E-173
sp|A7I1F0|LEPA_CAMHC Elongation factor 4 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=lepA PE=3 SV=1 47 644 2.0E-173
sp|Q6AEB5|LEPA_LEIXX Elongation factor 4 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=lepA PE=3 SV=1 50 649 2.0E-173
sp|Q6G8Y3|LEPA_STAAS Elongation factor 4 OS=Staphylococcus aureus (strain MSSA476) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|Q6GGB6|LEPA_STAAR Elongation factor 4 OS=Staphylococcus aureus (strain MRSA252) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|P65272|LEPA_STAAN Elongation factor 4 OS=Staphylococcus aureus (strain N315) GN=lepA PE=1 SV=1 47 644 3.0E-173
sp|P65271|LEPA_STAAM Elongation factor 4 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|Q2YT42|LEPA_STAAB Elongation factor 4 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|A5ITB2|LEPA_STAA9 Elongation factor 4 OS=Staphylococcus aureus (strain JH9) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|A6U257|LEPA_STAA2 Elongation factor 4 OS=Staphylococcus aureus (strain JH1) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|A7X2Y7|LEPA_STAA1 Elongation factor 4 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=lepA PE=3 SV=1 47 644 3.0E-173
sp|Q1QX26|LEPA_CHRSD Elongation factor 4 OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lepA PE=3 SV=1 50 644 3.0E-173
sp|Q5P089|LEPA_AROAE Elongation factor 4 OS=Aromatoleum aromaticum (strain EbN1) GN=lepA PE=3 SV=1 47 649 3.0E-173
sp|B4S9B7|LEPA_PROA2 Elongation factor 4 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=lepA PE=3 SV=1 50 645 3.0E-173
sp|C4L433|LEPA_EXISA Elongation factor 4 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=lepA PE=3 SV=1 35 645 4.0E-173
sp|B9GHA6|GUFP_POPTR Translation factor GUF1 homolog, chloroplastic OS=Populus trichocarpa GN=POPTRDRAFT_815670 PE=3 SV=2 38 644 4.0E-173
sp|B5ZAB8|LEPA_HELPG Elongation factor 4 OS=Helicobacter pylori (strain G27) GN=lepA PE=3 SV=1 45 644 4.0E-173
sp|B9F2U5|GUFP_ORYSJ Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. japonica GN=Os02g0157700 PE=3 SV=1 38 644 4.0E-173
sp|Q8NWA7|LEPA_STAAW Elongation factor 4 OS=Staphylococcus aureus (strain MW2) GN=lepA PE=3 SV=1 47 644 5.0E-173
sp|A8Z4C4|LEPA_STAAT Elongation factor 4 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=lepA PE=3 SV=1 47 644 5.0E-173
sp|A6QHC7|LEPA_STAAE Elongation factor 4 OS=Staphylococcus aureus (strain Newman) GN=lepA PE=3 SV=1 47 644 5.0E-173
sp|Q5HFH6|LEPA_STAAC Elongation factor 4 OS=Staphylococcus aureus (strain COL) GN=lepA PE=3 SV=1 47 644 5.0E-173
sp|Q2FXY7|LEPA_STAA8 Elongation factor 4 OS=Staphylococcus aureus (strain NCTC 8325) GN=lepA PE=1 SV=1 47 644 5.0E-173
sp|Q2FGD9|LEPA_STAA3 Elongation factor 4 OS=Staphylococcus aureus (strain USA300) GN=lepA PE=3 SV=1 47 644 5.0E-173
sp|Q9VRH6|GUF1_DROME Translation factor waclaw, mitochondrial OS=Drosophila melanogaster GN=waw PE=3 SV=2 1 646 5.0E-173
sp|Q8Y0I4|LEPA_RALSO Elongation factor 4 OS=Ralstonia solanacearum (strain GMI1000) GN=lepA PE=3 SV=1 47 644 6.0E-173
sp|B0RCT0|LEPA_CLAMS Elongation factor 4 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=lepA PE=3 SV=1 50 645 7.0E-173
sp|B3EE17|LEPA_CHLL2 Elongation factor 4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=lepA PE=3 SV=1 43 645 8.0E-173
sp|A5CR97|LEPA_CLAM3 Elongation factor 4 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=lepA PE=3 SV=1 50 645 8.0E-173
sp|Q6G1F5|LEPA_BARQU Elongation factor 4 OS=Bartonella quintana (strain Toulouse) GN=lepA PE=3 SV=1 50 640 9.0E-173
sp|Q8F500|LEPA_LEPIN Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lepA PE=3 SV=1 50 644 9.0E-173
sp|Q72QU8|LEPA_LEPIC Elongation factor 4 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lepA PE=3 SV=1 50 644 9.0E-173
sp|A3PHQ9|LEPA_RHOS1 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=lepA PE=3 SV=1 50 648 9.0E-173
sp|Q47WP3|LEPA_COLP3 Elongation factor 4 OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=lepA PE=3 SV=1 50 644 9.0E-173
sp|B7GRY7|LEPA_BIFLS Elongation factor 4 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=lepA PE=3 SV=1 50 645 9.0E-173
sp|Q9A9F4|LEPA_CAUCR Elongation factor 4 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lepA PE=3 SV=2 37 644 1.0E-172
sp|A2CBG9|LEPA_PROM3 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9303) GN=lepA PE=3 SV=1 44 644 1.0E-172
sp|A7H311|LEPA_CAMJD Elongation factor 4 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=lepA PE=3 SV=1 50 644 1.0E-172
sp|A6WKQ5|LEPA_SHEB8 Elongation factor 4 OS=Shewanella baltica (strain OS185) GN=lepA PE=3 SV=1 47 644 1.0E-172
sp|A3D1V4|LEPA_SHEB5 Elongation factor 4 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=lepA PE=3 SV=1 47 644 1.0E-172
sp|Q9FNM5|GUFP_ARATH Translation factor GUF1 homolog, chloroplastic OS=Arabidopsis thaliana GN=At5g08650 PE=2 SV=2 17 644 1.0E-172
sp|B1ZC10|LEPA_METPB Elongation factor 4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=lepA PE=3 SV=1 47 644 1.0E-172
sp|Q8UIQ2|LEPA_AGRFC Elongation factor 4 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lepA PE=3 SV=1 45 644 1.0E-172
sp|Q5HU70|LEPA_CAMJR Elongation factor 4 OS=Campylobacter jejuni (strain RM1221) GN=lepA PE=3 SV=1 44 644 2.0E-172
sp|A1W018|LEPA_CAMJJ Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=lepA PE=3 SV=1 44 644 2.0E-172
sp|Q9PNR1|LEPA_CAMJE Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=lepA PE=3 SV=1 44 644 2.0E-172
sp|A8FM79|LEPA_CAMJ8 Elongation factor 4 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=lepA PE=3 SV=1 44 644 2.0E-172
sp|Q64T74|LEPA_BACFR Elongation factor 4 OS=Bacteroides fragilis (strain YCH46) GN=lepA PE=3 SV=1 47 644 2.0E-172
sp|Q5LC85|LEPA_BACFN Elongation factor 4 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=lepA PE=3 SV=1 47 644 2.0E-172
sp|A9L5N4|LEPA_SHEB9 Elongation factor 4 OS=Shewanella baltica (strain OS195) GN=lepA PE=3 SV=1 47 644 2.0E-172
sp|B8EBQ4|LEPA_SHEB2 Elongation factor 4 OS=Shewanella baltica (strain OS223) GN=lepA PE=3 SV=1 47 644 2.0E-172
sp|Q0C5X0|LEPA_HYPNA Elongation factor 4 OS=Hyphomonas neptunium (strain ATCC 15444) GN=lepA PE=3 SV=1 45 644 2.0E-172
sp|Q73HR8|LEPA_WOLPM Elongation factor 4 OS=Wolbachia pipientis wMel GN=lepA PE=3 SV=1 50 640 2.0E-172
sp|C0R5S3|LEPA_WOLWR Elongation factor 4 OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=lepA PE=3 SV=1 50 640 2.0E-172
sp|Q21XN4|LEPA_RHOFT Elongation factor 4 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=lepA PE=3 SV=1 50 644 3.0E-172
sp|A5VB59|LEPA_SPHWW Elongation factor 4 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=lepA PE=3 SV=1 44 644 3.0E-172
sp|Q3MG20|LEPA_ANAVT Elongation factor 4 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=lepA PE=3 SV=1 44 644 3.0E-172
sp|Q8EH83|LEPA_SHEON Elongation factor 4 OS=Shewanella oneidensis (strain MR-1) GN=lepA PE=3 SV=1 50 644 3.0E-172
sp|Q11AY3|LEPA_CHESB Elongation factor 4 OS=Chelativorans sp. (strain BNC1) GN=lepA PE=3 SV=1 40 640 3.0E-172
sp|Q15R31|LEPA_PSEA6 Elongation factor 4 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=lepA PE=3 SV=1 50 644 4.0E-172
sp|Q8G603|LEPA_BIFLO Elongation factor 4 OS=Bifidobacterium longum (strain NCC 2705) GN=lepA PE=3 SV=1 50 645 4.0E-172
sp|B3DSA9|LEPA_BIFLD Elongation factor 4 OS=Bifidobacterium longum (strain DJO10A) GN=lepA PE=3 SV=1 50 645 4.0E-172
sp|Q9PQG7|LEPA_UREPA Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=lepA PE=3 SV=1 50 646 4.0E-172
sp|B1AIW2|LEPA_UREP2 Elongation factor 4 OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=lepA PE=3 SV=1 50 646 4.0E-172
sp|Q07YZ4|LEPA_SHEFN Elongation factor 4 OS=Shewanella frigidimarina (strain NCIMB 400) GN=lepA PE=3 SV=1 50 644 5.0E-172
sp|Q8CP13|LEPA_STAES Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lepA PE=3 SV=1 47 644 5.0E-172
sp|Q5HNW2|LEPA_STAEQ Elongation factor 4 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=lepA PE=3 SV=1 47 644 5.0E-172
sp|Q7NGX4|LEPA_GLOVI Elongation factor 4 OS=Gloeobacter violaceus (strain PCC 7421) GN=lepA PE=3 SV=1 43 644 6.0E-172
sp|B8H2Z7|LEPA_CAUCN Elongation factor 4 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lepA PE=3 SV=1 41 644 7.0E-172
sp|Q8YU48|LEPA_NOSS1 Elongation factor 4 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=lepA PE=3 SV=1 44 644 7.0E-172
sp|Q92SU3|LEPA_RHIME Elongation factor 4 OS=Rhizobium meliloti (strain 1021) GN=lepA PE=3 SV=1 45 644 7.0E-172
sp|P74751|LEPA_SYNY3 Elongation factor 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=lepA PE=3 SV=1 44 644 9.0E-172
sp|B5EQB5|LEPA_ACIF5 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=lepA PE=3 SV=1 47 644 1.0E-171
sp|B7J9J8|LEPA_ACIF2 Elongation factor 4 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=lepA PE=3 SV=1 47 644 1.0E-171
sp|Q12KH9|LEPA_SHEDO Elongation factor 4 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=lepA PE=3 SV=1 50 644 1.0E-171
sp|B0UFE0|LEPA_METS4 Elongation factor 4 OS=Methylobacterium sp. (strain 4-46) GN=lepA PE=3 SV=1 41 648 1.0E-171
sp|B2GHU9|LEPA_KOCRD Elongation factor 4 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=lepA PE=3 SV=1 50 645 2.0E-171
sp|Q1GIV5|LEPA_RUEST Elongation factor 4 OS=Ruegeria sp. (strain TM1040) GN=lepA PE=3 SV=1 48 644 2.0E-171
sp|Q30Q17|LEPA_SULDN Elongation factor 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=lepA PE=3 SV=1 50 644 2.0E-171
sp|B1X3K4|GUFP_PAUCH Translation factor GUF1 homolog, organellar chromatophore OS=Paulinella chromatophora GN=lepA PE=3 SV=1 45 645 2.0E-171
sp|Q2GJV7|LEPA_ANAPZ Elongation factor 4 OS=Anaplasma phagocytophilum (strain HZ) GN=lepA PE=3 SV=1 50 640 2.0E-171
sp|Q7UX15|LEPA1_RHOBA Elongation factor 4 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=lepA1 PE=3 SV=1 47 645 3.0E-171
sp|Q3ALG5|LEPA_SYNSC Elongation factor 4 OS=Synechococcus sp. (strain CC9605) GN=lepA PE=3 SV=1 45 649 3.0E-171
sp|B8IMT0|LEPA_METNO Elongation factor 4 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=lepA PE=3 SV=1 41 648 3.0E-171
sp|Q7U5L9|LEPA_SYNPX Elongation factor 4 OS=Synechococcus sp. (strain WH8102) GN=lepA PE=3 SV=1 45 649 3.0E-171
sp|Q83BK3|LEPA_COXBU Elongation factor 4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=lepA PE=3 SV=2 50 644 3.0E-171
sp|A9N944|LEPA_COXBR Elongation factor 4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=lepA PE=3 SV=1 50 644 3.0E-171
sp|Q0HSI9|LEPA_SHESR Elongation factor 4 OS=Shewanella sp. (strain MR-7) GN=lepA PE=3 SV=1 50 644 3.0E-171
sp|Q0HG96|LEPA_SHESM Elongation factor 4 OS=Shewanella sp. (strain MR-4) GN=lepA PE=3 SV=1 50 644 3.0E-171
sp|B7KR78|LEPA_METC4 Elongation factor 4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=lepA PE=3 SV=1 47 644 3.0E-171
sp|A9A0N0|LEPA_DESOH Elongation factor 4 OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=lepA PE=3 SV=1 48 644 6.0E-171
sp|A0KZN4|LEPA_SHESA Elongation factor 4 OS=Shewanella sp. (strain ANA-3) GN=lepA PE=3 SV=1 50 644 7.0E-171
sp|A9KF98|LEPA_COXBN Elongation factor 4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=lepA PE=3 SV=1 50 644 7.0E-171
sp|Q68X95|LEPA_RICTY Elongation factor 4 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=lepA PE=3 SV=1 50 644 8.0E-171
sp|Q5LUS0|LEPA_RUEPO Elongation factor 4 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lepA PE=3 SV=1 50 648 9.0E-171
sp|B8AI54|GUFP_ORYSI Translation factor GUF1 homolog, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_05919 PE=3 SV=1 50 644 1.0E-170
sp|A4WX88|LEPA_RHOS5 Elongation factor 4 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=lepA PE=3 SV=1 50 648 1.0E-170
sp|A9BE39|LEPA_PROM4 Elongation factor 4 OS=Prochlorococcus marinus (strain MIT 9211) GN=lepA PE=3 SV=1 44 648 1.0E-170
sp|Q0ATE3|LEPA_MARMM Elongation factor 4 OS=Maricaulis maris (strain MCS10) GN=lepA PE=3 SV=2 50 644 1.0E-170
sp|Q182F4|LEPA_PEPD6 Elongation factor 4 OS=Peptoclostridium difficile (strain 630) GN=lepA PE=3 SV=1 48 644 1.0E-170
sp|Q1J6V6|LEPA_STRPF Elongation factor 4 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=lepA PE=3 SV=1 34 626 1.0E-170
sp|Q5GRW9|LEPA_WOLTR Elongation factor 4 OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=lepA PE=3 SV=1 47 640 2.0E-170
sp|Q8FV17|LEPA_BRUSU Elongation factor 4 OS=Brucella suis biovar 1 (strain 1330) GN=lepA PE=3 SV=1 43 640 2.0E-170
sp|A9WW49|LEPA_BRUSI Elongation factor 4 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=lepA PE=3 SV=1 43 640 2.0E-170
sp|A5VVU4|LEPA_BRUO2 Elongation factor 4 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=lepA PE=3 SV=1 43 640 2.0E-170
sp|A9MCW5|LEPA_BRUC2 Elongation factor 4 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=lepA PE=3 SV=1 43 640 2.0E-170
sp|Q7VDF7|LEPA_PROMA Elongation factor 4 OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=lepA PE=3 SV=1 44 644 2.0E-170
sp|C5BRN3|LEPA_TERTT Elongation factor 4 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=lepA PE=3 SV=1 50 644 2.0E-170
sp|B6JJT7|LEPA_OLICO Elongation factor 4 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=lepA PE=3 SV=1 45 644 3.0E-170
sp|Q1AVV0|LEPA_RUBXD Elongation factor 4 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=lepA PE=3 SV=1 40 640 3.0E-170
sp|Q892Q6|LEPA_CLOTE Elongation factor 4 OS=Clostridium tetani (strain Massachusetts / E88) GN=lepA PE=3 SV=2 47 644 3.0E-170
sp|Q9RDC9|LEPA_STRCO Elongation factor 4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lepA PE=3 SV=1 50 645 3.0E-170
sp|A4XSC1|LEPA_PSEMY Elongation factor 4 OS=Pseudomonas mendocina (strain ymp) GN=lepA PE=3 SV=1 50 644 3.0E-170
sp|Q050R3|LEPA_LEPBL Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=lepA PE=3 SV=1 50 644 4.0E-170
sp|Q04SN9|LEPA_LEPBJ Elongation factor 4 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=lepA PE=3 SV=1 50 644 4.0E-170
sp|A5N6L8|LEPA_CLOK5 Elongation factor 4 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=lepA PE=3 SV=1 46 644 4.0E-170
sp|Q28LR4|LEPA_JANSC Elongation factor 4 OS=Jannaschia sp. (strain CCS1) GN=lepA PE=3 SV=1 48 644 4.0E-170
sp|C4LBZ6|LEPA_TOLAT Elongation factor 4 OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=lepA PE=3 SV=1 50 644 4.0E-170
sp|Q1I5V6|LEPA_PSEE4 Elongation factor 4 OS=Pseudomonas entomophila (strain L48) GN=lepA PE=3 SV=1 50 644 5.0E-170
sp|Q88MY7|LEPA_PSEPK Elongation factor 4 OS=Pseudomonas putida (strain KT2440) GN=lepA PE=3 SV=1 50 644 5.0E-170
sp|A1R6W8|LEPA_ARTAT Elongation factor 4 OS=Arthrobacter aurescens (strain TC1) GN=lepA PE=3 SV=1 50 645 6.0E-170
sp|A5W8F4|LEPA_PSEP1 Elongation factor 4 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lepA PE=3 SV=1 50 644 6.0E-170
sp|B3Q991|LEPA_RHOPT Elongation factor 4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=lepA PE=3 SV=1 45 644 6.0E-170
sp|P60793|LEPA_RHOPA Elongation factor 4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=lepA PE=3 SV=1 45 644 6.0E-170
sp|A2C0M8|LEPA_PROM1 Elongation factor 4 OS=Prochlorococcus marinus (strain NATL1A) GN=lepA PE=3 SV=1 44 644 6.0E-170
sp|A4VIX2|LEPA_PSEU5 Elongation factor 4 OS=Pseudomonas stutzeri (strain A1501) GN=lepA PE=3 SV=1 50 644 6.0E-170
sp|Q576S5|LEPA_BRUAB Elongation factor 4 OS=Brucella abortus biovar 1 (strain 9-941) GN=lepA PE=3 SV=1 43 640 7.0E-170
sp|Q2YJP8|LEPA_BRUA2 Elongation factor 4 OS=Brucella abortus (strain 2308) GN=lepA PE=3 SV=1 43 640 7.0E-170
sp|B2SC25|LEPA_BRUA1 Elongation factor 4 OS=Brucella abortus (strain S19) GN=lepA PE=3 SV=1 43 640 7.0E-170
sp|Q0BRZ7|LEPA_GRABC Elongation factor 4 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=lepA PE=3 SV=2 44 644 7.0E-170
[Show less]

GO

GO Term Description Terminal node
GO:0003924 GTPase activity Yes
GO:0003697 single-stranded DNA binding Yes
GO:0005525 GTP binding Yes
GO:0018142 protein-DNA covalent cross-linking Yes
GO:0006974 cellular response to DNA damage stimulus Yes
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003677 DNA binding No
GO:0019538 protein metabolic process No
GO:0019001 guanyl nucleotide binding No
GO:0051716 cellular response to stimulus No
GO:0018143 nucleic acid-protein covalent cross-linking No
GO:0043170 macromolecule metabolic process No
GO:0050896 response to stimulus No
GO:0036211 protein modification process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006950 response to stress No
GO:0000166 nucleotide binding No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0016462 pyrophosphatase activity No
GO:0003676 nucleic acid binding No
GO:0032555 purine ribonucleotide binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0033554 cellular response to stress No
GO:0017076 purine nucleotide binding No
GO:0043412 macromolecule modification No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup685
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|614
Ophiocordyceps australis map64 (Brazil) OphauB2|5428
Ophiocordyceps camponoti-floridani Ophcf2|02496
Ophiocordyceps camponoti-rufipedis Ophun1|1349 (this protein)
Ophiocordyceps kimflemingae Ophio5|2673
Ophiocordyceps subramaniannii Hirsu2|11205

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1349
MRWAWRAGRAWSRPWLAGRSPFPRGFASEVKSRSKELEERIEAIPTERYRNFCIVAHIDHGKSTLSDRLLEFTKT
ISKSDANKQILDKLDVERERGITVKAQTCSMIYNYEGQDYLLHLVDTPGHVDFRAEVTRSYASCDGALLLIDATQ
GIQAQTVSNFHLAFAQDLALVPVINKTDMASADVPRVLDQMETTLELPREDALLVSAKTGRGVPDVLAAVVRHIP
PPVGDSDKPLKMLLVDSWYDNFRGVVMLVRVFEGCVRARDAVVSLGTGTTYFVGEVGVHYPDATPQNVLRAGQVG
YMFFSPGMKRIQDAKLGDTFTTVGNVDVVKPCPGFEEPKPMVFAAAFPTDQGEYHRLADSMNQLVLNDRSVTLQP
EFSEALGAGWRLGFLGSLHCSVFEDRLRQEHGRSIIITEPTVPTKIIWPDESEQLVQNPIHFPDAADARVRDATL
MEPYVHATVTVPQEFLGNAIELCEANRGEQKSLEFFDAKQAILLYDIPAAQLVEDLFDKLKSASKGYATLDYEDA
GWRKSDLVKLQLTVNKQPVDSICRVVHKSQAERVARRWVTKFKEHVDRQMFEIIIQAVVGKKVLARETIKPFRKD
VLAKLHASDITRRQKLLSKQKEGRKRLQAIGNVSIPHEAFQSFLSKASGVDFQGPASQVRQMLEDDAMAVDEAPD
DQDNASRQSHNFAPGYHGIVYRAATPDRGAGSAPAGGERRYRLQAMKWGLIPFWTKRNPDYGTMLKTINCRDDSL
ASPGGVWAAIKGRKRCLVIAQGFYEWLKKGPREKMPHFVRRRDGKLMCLAGLWDCVQYQDSDEKTYSYTIITTSS
NPQLRFLHDRMPVILDPGSDDVTTWLDPGRSEWDEVLQGLLRPYDGELEVYPVSKEVGK*
Coding >Ophun1|1349
ATGAGATGGGCATGGAGAGCTGGGCGGGCCTGGAGTCGGCCATGGCTCGCTGGACGGTCTCCGTTCCCTCGGGGC
TTCGCGTCCGAGGTCAAGTCTCGGTCGAAAGAGCTGGAGGAGCGGATCGAGGCGATTCCCACCGAGCGGTACAGG
AACTTTTGCATCGTCGCACACATTGATCACGGCAAGAGCACGCTCAGCGATCGGCTGCTGGAGTTTACCAAGACC
ATTTCCAAGAGCGATGCGAATAAGCAGATTCTCGACAAGCTCGACGTGGAGCGCGAACGAGGCATCACGGTCAAG
GCACAGACATGCTCCATGATCTACAACTACGAAGGCCAAGATTACCTACTGCACCTCGTCGACACGCCGGGTCAC
GTCGACTTCCGGGCCGAGGTGACGCGCTCATACGCCAGCTGCGACGGCGCGCTGCTGCTCATCGACGCGACCCAA
GGCATCCAGGCGCAGACGGTGTCCAACTTTCATCTGGCCTTTGCCCAGGACCTGGCCCTGGTGCCCGTCATCAAC
AAGACGGACATGGCGTCGGCCGACGTGCCGCGTGTGCTGGACCAGATGGAGACGACGCTGGAGCTGCCACGCGAA
GACGCTCTGTTGGTAAGCGCAAAGACGGGCCGCGGCGTGCCGGACGTGCTGGCGGCTGTGGTGAGGCATATTCCG
CCCCCCGTCGGCGATTCGGACAAGCCGCTGAAGATGCTGCTGGTCGATTCGTGGTACGACAACTTCCGTGGCGTC
GTCATGCTGGTCCGCGTCTTCGAGGGCTGTGTCCGCGCCCGTGACGCCGTCGTCTCCCTCGGCACTGGCACCACC
TACTTTGTCGGTGAGGTTGGCGTCCATTATCCGGACGCCACGCCCCAGAACGTCTTGCGCGCTGGCCAGGTCGGT
TACATGTTCTTCAGCCCGGGCATGAAGCGCATTCAAGACGCCAAGCTGGGAGATACCTTTACTACCGTTGGCAAC
GTCGATGTCGTCAAGCCTTGTCCCGGCTTCGAAGAGCCCAAGCCCATGGTCTTCGCCGCCGCCTTTCCCACAGAC
CAGGGCGAATACCACAGGCTGGCCGACAGTATGAACCAGCTCGTCCTCAACGACCGCAGCGTCACGCTGCAGCCC
GAGTTCTCCGAAGCCCTTGGAGCTGGCTGGCGCCTGGGCTTCCTCGGCAGTCTACACTGTTCCGTCTTTGAGGAC
CGGCTGAGACAAGAGCACGGTCGAAGCATCATCATAACCGAGCCTACGGTGCCAACCAAGATCATCTGGCCCGAC
GAGTCTGAACAACTGGTGCAGAACCCGATCCATTTCCCAGACGCGGCGGATGCGCGCGTTCGCGACGCCACCCTC
ATGGAGCCTTACGTGCACGCGACCGTCACCGTGCCGCAGGAGTTTCTAGGCAACGCCATCGAACTATGTGAGGCC
AATCGCGGGGAGCAGAAGAGCCTCGAATTCTTCGACGCAAAGCAAGCTATCCTGCTTTACGATATTCCCGCCGCA
CAGCTGGTTGAGGACCTCTTTGACAAGCTCAAGAGCGCCAGCAAGGGATACGCAACCTTAGACTACGAAGACGCT
GGTTGGCGCAAGAGCGATCTGGTCAAGCTGCAACTTACCGTCAACAAGCAGCCAGTCGACTCTATCTGTCGGGTG
GTGCACAAGTCACAGGCGGAGCGCGTGGCCCGAAGATGGGTTACCAAATTCAAGGAACACGTCGACCGGCAGATG
TTTGAGATCATCATCCAGGCCGTGGTTGGCAAAAAGGTGCTGGCGCGGGAGACCATCAAGCCCTTCCGCAAAGAC
GTGTTGGCCAAGCTGCATGCCAGCGATATTACGCGGCGCCAGAAGCTGCTCAGCAAGCAGAAGGAGGGTAGAAAG
CGGCTTCAAGCCATAGGAAACGTCTCCATTCCCCATGAGGCATTCCAGAGCTTCCTGTCCAAGGCCTCTGGCGTT
GATTTTCAGGGTCCGGCGTCGCAGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTCGACGAAGCGCCAGAC
GATCAAGACAACGCAAGCCGCCAGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTCTACCGCGCCGCCACG
CCGGACCGGGGCGCCGGCTCGGCTCCGGCCGGGGGGGAGCGGCGATACCGACTGCAGGCCATGAAGTGGGGGCTG
ATACCCTTCTGGACGAAGCGGAACCCGGACTACGGGACGATGCTCAAGACTATCAACTGCAGGGACGACTCGCTG
GCTTCTCCGGGGGGGGTGTGGGCTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAGGGCTTCTATGAG
TGGTTGAAGAAGGGGCCGAGGGAGAAGATGCCGCATTTTGTGAGGAGGCGGGATGGGAAGCTCATGTGTTTGGCT
GGGCTGTGGGATTGCGTCCAGTATCAAGACTCGGACGAAAAGACATACTCGTACACCATCATCACCACCTCTTCT
AACCCCCAGCTCCGCTTCCTGCACGACCGCATGCCCGTCATCCTCGACCCGGGCAGCGACGACGTCACGACATGG
CTTGATCCGGGCCGGAGCGAGTGGGATGAGGTGCTGCAGGGCTTGCTGCGGCCCTATGACGGTGAGCTGGAGGTG
TATCCCGTCAGCAAGGAGGTTGGCAAGTAA
Transcript >Ophun1|1349
ATGAGATGGGCATGGAGAGCTGGGCGGGCCTGGAGTCGGCCATGGCTCGCTGGACGGTCTCCGTTCCCTCGGGGC
TTCGCGTCCGAGGTCAAGTCTCGGTCGAAAGAGCTGGAGGAGCGGATCGAGGCGATTCCCACCGAGCGGTACAGG
AACTTTTGCATCGTCGCACACATTGATCACGGCAAGAGCACGCTCAGCGATCGGCTGCTGGAGTTTACCAAGACC
ATTTCCAAGAGCGATGCGAATAAGCAGATTCTCGACAAGCTCGACGTGGAGCGCGAACGAGGCATCACGGTCAAG
GCACAGACATGCTCCATGATCTACAACTACGAAGGCCAAGATTACCTACTGCACCTCGTCGACACGCCGGGTCAC
GTCGACTTCCGGGCCGAGGTGACGCGCTCATACGCCAGCTGCGACGGCGCGCTGCTGCTCATCGACGCGACCCAA
GGCATCCAGGCGCAGACGGTGTCCAACTTTCATCTGGCCTTTGCCCAGGACCTGGCCCTGGTGCCCGTCATCAAC
AAGACGGACATGGCGTCGGCCGACGTGCCGCGTGTGCTGGACCAGATGGAGACGACGCTGGAGCTGCCACGCGAA
GACGCTCTGTTGGTAAGCGCAAAGACGGGCCGCGGCGTGCCGGACGTGCTGGCGGCTGTGGTGAGGCATATTCCG
CCCCCCGTCGGCGATTCGGACAAGCCGCTGAAGATGCTGCTGGTCGATTCGTGGTACGACAACTTCCGTGGCGTC
GTCATGCTGGTCCGCGTCTTCGAGGGCTGTGTCCGCGCCCGTGACGCCGTCGTCTCCCTCGGCACTGGCACCACC
TACTTTGTCGGTGAGGTTGGCGTCCATTATCCGGACGCCACGCCCCAGAACGTCTTGCGCGCTGGCCAGGTCGGT
TACATGTTCTTCAGCCCGGGCATGAAGCGCATTCAAGACGCCAAGCTGGGAGATACCTTTACTACCGTTGGCAAC
GTCGATGTCGTCAAGCCTTGTCCCGGCTTCGAAGAGCCCAAGCCCATGGTCTTCGCCGCCGCCTTTCCCACAGAC
CAGGGCGAATACCACAGGCTGGCCGACAGTATGAACCAGCTCGTCCTCAACGACCGCAGCGTCACGCTGCAGCCC
GAGTTCTCCGAAGCCCTTGGAGCTGGCTGGCGCCTGGGCTTCCTCGGCAGTCTACACTGTTCCGTCTTTGAGGAC
CGGCTGAGACAAGAGCACGGTCGAAGCATCATCATAACCGAGCCTACGGTGCCAACCAAGATCATCTGGCCCGAC
GAGTCTGAACAACTGGTGCAGAACCCGATCCATTTCCCAGACGCGGCGGATGCGCGCGTTCGCGACGCCACCCTC
ATGGAGCCTTACGTGCACGCGACCGTCACCGTGCCGCAGGAGTTTCTAGGCAACGCCATCGAACTATGTGAGGCC
AATCGCGGGGAGCAGAAGAGCCTCGAATTCTTCGACGCAAAGCAAGCTATCCTGCTTTACGATATTCCCGCCGCA
CAGCTGGTTGAGGACCTCTTTGACAAGCTCAAGAGCGCCAGCAAGGGATACGCAACCTTAGACTACGAAGACGCT
GGTTGGCGCAAGAGCGATCTGGTCAAGCTGCAACTTACCGTCAACAAGCAGCCAGTCGACTCTATCTGTCGGGTG
GTGCACAAGTCACAGGCGGAGCGCGTGGCCCGAAGATGGGTTACCAAATTCAAGGAACACGTCGACCGGCAGATG
TTTGAGATCATCATCCAGGCCGTGGTTGGCAAAAAGGTGCTGGCGCGGGAGACCATCAAGCCCTTCCGCAAAGAC
GTGTTGGCCAAGCTGCATGCCAGCGATATTACGCGGCGCCAGAAGCTGCTCAGCAAGCAGAAGGAGGGTAGAAAG
CGGCTTCAAGCCATAGGAAACGTCTCCATTCCCCATGAGGCATTCCAGAGCTTCCTGTCCAAGGCCTCTGGCGTT
GATTTTCAGGGTCCGGCGTCGCAGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTCGACGAAGCGCCAGAC
GATCAAGACAACGCAAGCCGCCAGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTCTACCGCGCCGCCACG
CCGGACCGGGGCGCCGGCTCGGCTCCGGCCGGGGGGGAGCGGCGATACCGACTGCAGGCCATGAAGTGGGGGCTG
ATACCCTTCTGGACGAAGCGGAACCCGGACTACGGGACGATGCTCAAGACTATCAACTGCAGGGACGACTCGCTG
GCTTCTCCGGGGGGGGTGTGGGCTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAGGGCTTCTATGAG
TGGTTGAAGAAGGGGCCGAGGGAGAAGATGCCGCATTTTGTGAGGAGGCGGGATGGGAAGCTCATGTGTTTGGCT
GGGCTGTGGGATTGCGTCCAGTATCAAGACTCGGACGAAAAGACATACTCGTACACCATCATCACCACCTCTTCT
AACCCCCAGCTCCGCTTCCTGCACGACCGCATGCCCGTCATCCTCGACCCGGGCAGCGACGACGTCACGACATGG
CTTGATCCGGGCCGGAGCGAGTGGGATGAGGTGCTGCAGGGCTTGCTGCGGCCCTATGACGGTGAGCTGGAGGTG
TATCCCGTCAGCAAGGAGGTTGGCAAGTAA
Gene >Ophun1|1349
ATGAGATGGGCATGGAGAGCTGGGCGGGCCTGGAGTCGGCCATGGCTCGCTGGACGGTCTCCGTTCCCTCGGGGC
TTCGCGTCCGAGGTCAAGTCTCGGTCGAAAGAGCTGGAGGAGCGGATCGAGGCGATTCCCACCGAGCGGTACAGG
AACTTTTGCATCGTCGCACACATTGATCACGGCAAGAGCACGCTCAGCGATCGGCTGCTGGAGTTTACCAAGACC
ATTTCCAAGAGCGATGCGAATAAGCAGATTCTCGTGCGTGTCCAGCGACCTTTACATGTCCGCCGATGAGGCTGA
TCAAGATGGCGACAGGACAAGCTCGACGTGGAGCGCGAACGAGGCATCACGGTCAAGGCACAGACATGCTCCATG
ATCTACAACTACGAAGGCCAAGATTACCTACTGCACCTCGTCGACACGCCGGGTCACGTCGACTTCCGGGCCGAG
GTGACGCGCTCATACGCCAGCTGCGACGGCGCGCTGCTGCTCATCGACGCGACCCAAGGCATCCAGGCGCAGACG
GTGTCCAACTTTCATCTGGCCTTTGCCCAGGACCTGGCCCTGGTGCCCGTCATCAACAAGACGGACATGGCGTCG
GCCGACGTGCCGCGTGTGCTGGACCAGATGGAGACGACGCTGGAGCTGCCACGCGAAGACGCTCTGTTGGTAAGC
GCAAAGACGGGCCGCGGCGTGCCGGACGTGCTGGCGGCTGTGGTGAGGCATATTCCGCCCCCCGTCGGCGATTCG
GACAAGCCGCTGAAGATGCTGCTGGTCGATTCGTGGTACGACAACTTCCGTGGCGTCGTCATGCTGGTCCGCGTC
TTCGAGGGCTGTGTCCGCGCCCGTGACGCCGTCGTCTCCCTCGGCACTGGCACCACCTACTTTGTCGGTGAGGTT
GGCGTCCATTATCCGGACGCCACGCCCCAGAACGTCTTGCGCGCTGGCCAGGTCGGTTACATGTTCTTCAGCCCG
GGCATGAAGCGCATTCAAGACGCCAAGCTGGGAGATACCTTTACTACCGTTGGCAACGTCGATGTCGTCAAGCCT
TGTCCCGGCTTCGAAGAGCCCAAGCCCATGGTCTTCGCCGCCGCCTTTCCCACAGACCAGGGCGAATACCACAGG
CTGGCCGACAGTATGAACCAGCTCGTCCTCAACGACCGCAGCGTCACGCTGCAGCCCGAGTTCTCCGAAGCCCTT
GGAGCTGGCTGGCGCCTGGGCTTCCTCGGCAGTCTACACTGTTCCGTCTTTGAGGACCGGCTGAGACAAGAGCAC
GGTCGAAGCATCATCATAACCGAGCCTACGGTGCCAACCAAGATCATCTGGCCCGACGAGTCTGAACAACTGGTG
CAGAACCCGATCCATTTCCCAGACGCGGCGGATGCGCGCGTTCGCGACGCCACCCTCATGGAGCCGTAAGTTGGA
TCGTGTTCTGGAGATACCAAGGACCGTCTAACAGGGGGGAATCGGGAAAGTTACGTGCACGCGACCGTCACCGTG
CCGCAGGAGTTTCTAGGCAACGCCATCGAACTATGTGAGGCCAATCGCGGGGAGCAGAAGAGCCTCGAATTCTTC
GACGCAAAGCAAGCTATCCTGCTTTACGATATTCCCGCCGCACAGCTGGTTGAGGACCTCTTTGACAAGCTCAAG
AGCGCCAGGTGAGACGAGCGATTAGATCCTAACAAGCATATCGGGTGCTGACGAGCGCCGGATTACAGCAAGGGA
TACGCAACCTTAGACTACGAAGACGCTGGTTGGCGCAAGAGCGATCTGGTCAAGCTGCAACTTACCGTCAACAAG
CAGCCAGTCGACTCTATCTGTCGGGTGGTGCACAAGTCACAGGCGGAGCGCGTGGCCCGAAGATGGGTTACCAAA
TTCAAGGAACACGTCGACCGGCAGATGTTTGGTTCGTTTTGTCTCTGACTTGGTTACGAAGAAGCCGCTGACTGT
CGACTGCAGAGATCATCATCCAGGCCGTGGTTGGCAAAAAGGTGCTGGCGCGGGAGACCATCAAGCCCTTCCGCA
AAGACGTGTTGGCCAAGCTGCATGCCAGCGATATTACGCGGCGCCAGAAGCTGCTCAGCAAGCAGAAGGAGGGTA
GAAAGCGGCTTCAAGCCATAGGAAACGTCTCCATTCCCCATGAGGCATTCCAGAGCTTCCTGTCCAAGTCATGAG
GCAGAGGCGGAGGGTATCTCGGGTCTTGTGCTGAGCTCCCTCGTGAAGGGCCTCTGGCGTTGATTTTCAGGGTGT
ATTGTAGATACGACCTCTGTCGCCAACAATTGGAATACCATAATGAGTCCTCGGTACGGACAGTGAAACATCCTT
CGCGAGTTGAAGCTCGAGACACTGATGTCATAGCGCTGCACGTGACCTCGCGGTGAAGACCTTCTAGTGCGGTGT
GCGCCCGACGCGTTGAGAGATTCTCTCTACACTGCCCAAGAGACCGATCACTAGCAGCAGCATGTGTGGCCGTTA
CGCGCTGGCCTTGGTGGGCTCCACGGGTCGAGATTCGCAACAGGCTGGATACTGACGACCAGCAGCCGGCGTCGC
AGGTTCGACAGATGCTCGAGGATGACGCCATGGCCGTCGACGAAGCGCCAGACGATCAAGACAACGCAAGCCGCC
AGTCTCACAACTTTGCCCCGGGCTACCACGGCATCGTCTACCGCGCCGCCACGCCGGACCGGGGCGCCGGCTCGG
CTCCGGCCGGGGGGGAGCGGCGATACCGACTGCAGGCCATGAAGTGGGGGCTGATACCCTTCTGGACGAAGCGGA
ACCCGGACTACGGGACGATGCTCAAGACTATCAACTGCAGGGACGACTCGCTGGCTTCTCCGGGGGGGGTGTGGG
CTGCTATCAAGGGACGGAAGCGCTGTCTTGTTATTGCTCAGGGCTTCTATGAGTGGTTGAAGAAGGGGCCGAGGG
AGAAGATGCCGCATTTTGTGAGGAGGCGGGATGGGAAGCTCATGTGTTTGGCTGGGCTGTGGGATTGCGTCCAGT
ATCAAGGTGAGGAATTCAGTTCGGCTGCTGGCAGAGTCTCTCGCTTACATGACCTACTAAGACTCGGACGAAAAG
ACATACTCGTACACCATCATCACCACCTCTTCTAACCCCCAGCTCCGCTTCCTGCACGACCGCATGCCCGTCATC
CTCGACCCGGGCAGCGACGACGTCACGACATGGCTTGATCCGGGCCGGAGCGAGTGGGATGAGGTGCTGCAGGGC
TTGCTGCGGCCCTATGACGGTGAGCTGGAGGTGTATCCCGTCAGCAAGGAGGTTGGCAAGGTGGGCAACGACTCG
CCGTCGTTTATTGTCCCGCTGGATAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail