Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1346
Gene name
LocationContig_153:22343..24260
Strand-
Gene length (bp)1917
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08216 CTNNBL Catenin-beta-like, Arm-motif containing nuclear 2.0E-174 93 559

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UUK1|CTBL1_SCHPO Beta-catenin-like protein 1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctnnbl1 PE=1 SV=1 80 576 1.0E-99
sp|Q8WYA6|CTBL1_HUMAN Beta-catenin-like protein 1 OS=Homo sapiens GN=CTNNBL1 PE=1 SV=1 73 566 2.0E-81
sp|Q4V8K2|CTBL1_RAT Beta-catenin-like protein 1 OS=Rattus norvegicus GN=Ctnnbl1 PE=1 SV=1 112 566 3.0E-79
sp|Q9CWL8|CTBL1_MOUSE Beta-catenin-like protein 1 OS=Mus musculus GN=Ctnnbl1 PE=1 SV=1 112 566 2.0E-78
sp|O62703|CTBL1_BOVIN Beta-catenin-like protein 1 OS=Bos taurus GN=CTNNBL1 PE=2 SV=3 112 566 7.0E-78

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1523
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3642
Ophiocordyceps australis map64 (Brazil) OphauB2|5430
Ophiocordyceps camponoti-floridani Ophcf2|02498
Ophiocordyceps camponoti-rufipedis Ophun1|1346 (this protein)
Ophiocordyceps kimflemingae Ophio5|2671
Ophiocordyceps subramaniannii Hirsu2|11203

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1346
MASVDDIFKNVGLPSKRKREAIADPNELYKSSKLTASSHRTRNEAEADATVAEDDDELEAGPAPPPQQGEADEEG
DDDEGRFFGGGISAKESEVLDFVAGAGEDADRGPEKIDVAWMRRTAQTLEKRIATNTRLRAKFEGDPQKFIASEA
ELDADVKALSILSEHPELYPDFVVLGCAVHLVGLLAHDNTDIAIDALEIIGELTDEDVAADDSQWDALVDALLDA
DLIGLLVSNLARLDEADEADRNGVYYALGIVENLCSRSATAARIGAHDALLGWLLQRIQRQEQPITVSQNKQYAA
EILAILSQSAAEIRRQMAARDAIDIMLQLVAAYRKRDPDKGGEEEEYMENLFEALTCLVDEPSGKAKFIEAEGVE
LCLIMFREGKRSKAPALRLMDHATGGASTAAVDVCVKIVDAGGLRPLFTLFIKSRDRRLQGHMLGVLASMMRLLP
AGSAERIRTLAKFVEKDYEKTAKLVQLHADFGALVRRAEAQHRRDAAGVDPTEAEVELLSRRLDAGLFALQQVDV
LLAWLAAEDGGARKRIERLLGDRDESFATVAAIIKEQREGLDTTEEDSKDMSDMLDTLLEFVR*
Coding >Ophun1|1346
ATGGCGAGCGTCGACGACATCTTCAAGAACGTCGGCCTGCCCAGCAAGCGAAAACGAGAAGCCATCGCCGATCCG
AACGAACTCTATAAATCGAGCAAACTCACCGCCTCAAGCCACCGAACTCGCAACGAAGCCGAGGCTGATGCCACT
GTTGCCGAAGACGATGACGAGCTCGAAGCCGGTCCCGCGCCACCGCCGCAGCAGGGAGAGGCAGACGAAGAAGGC
GACGATGACGAAGGCCGCTTCTTCGGCGGCGGCATCTCGGCGAAAGAGTCCGAGGTGCTCGACTTCGTAGCCGGC
GCAGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACGGCTCAGACGCTGGAA
AAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGTTCGAGGGCGATCCGCAAAAGTTCATCGCCAGCGAAGCC
GAGCTCGACGCCGACGTCAAAGCCTTGTCGATTCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTCGTCCTC
GGCTGCGCCGTCCATCTCGTCGGTCTCCTCGCTCACGACAATACCGACATCGCCATCGACGCCTTGGAAATCATT
GGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTGGACGCTCTGCTCGACGCC
GATCTCATCGGTCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAGGCCGATGAAGCCGACCGAAACGGCGTCTAT
TACGCTCTCGGTATCGTCGAGAATCTCTGCTCACGCTCGGCCACGGCCGCTCGCATCGGCGCTCACGACGCCCTT
CTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAGAACAAGCAATACGCGGCC
GAGATTCTCGCCATCCTCTCCCAGTCCGCGGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATCGACATC
ATGCTACAGCTCGTCGCCGCATACCGCAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATGGAGAAC
CTCTTCGAAGCCCTCACCTGCCTCGTCGACGAGCCATCGGGAAAGGCCAAGTTCATCGAGGCCGAGGGCGTCGAG
CTCTGCCTCATCATGTTCAGGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTCCGCCTGATGGACCACGCCACGGGC
GGCGCTTCGACCGCTGCCGTAGATGTGTGCGTCAAGATCGTCGACGCCGGCGGCCTGCGCCCCCTGTTCACCCTC
TTCATCAAGAGCCGCGATCGGCGCCTGCAGGGCCACATGCTCGGTGTGCTGGCGTCGATGATGCGCCTGCTGCCG
GCCGGTTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAACTTGTG
CAGCTTCATGCCGACTTTGGCGCTCTCGTCAGGCGTGCCGAGGCTCAGCATCGTCGGGACGCCGCGGGGGTGGAC
CCGACCGAGGCAGAGGTCGAGCTGCTGTCGCGGAGGCTCGATGCTGGGCTCTTCGCCCTGCAGCAGGTGGATGTC
TTGCTGGCCTGGTTGGCGGCCGAGGACGGCGGAGCGAGGAAACGGATCGAGCGGCTGCTGGGAGACCGGGATGAG
AGCTTTGCTACTGTGGCGGCCATCATCAAGGAGCAGCGGGAGGGTTTAGATACCACGGAGGAGGACAGCAAGGAT
ATGAGCGACATGTTAGATACACTGCTGGAGTTTGTGCGGTAG
Transcript >Ophun1|1346
ATGGCGAGCGTCGACGACATCTTCAAGAACGTCGGCCTGCCCAGCAAGCGAAAACGAGAAGCCATCGCCGATCCG
AACGAACTCTATAAATCGAGCAAACTCACCGCCTCAAGCCACCGAACTCGCAACGAAGCCGAGGCTGATGCCACT
GTTGCCGAAGACGATGACGAGCTCGAAGCCGGTCCCGCGCCACCGCCGCAGCAGGGAGAGGCAGACGAAGAAGGC
GACGATGACGAAGGCCGCTTCTTCGGCGGCGGCATCTCGGCGAAAGAGTCCGAGGTGCTCGACTTCGTAGCCGGC
GCAGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACGGCTCAGACGCTGGAA
AAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGTTCGAGGGCGATCCGCAAAAGTTCATCGCCAGCGAAGCC
GAGCTCGACGCCGACGTCAAAGCCTTGTCGATTCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTCGTCCTC
GGCTGCGCCGTCCATCTCGTCGGTCTCCTCGCTCACGACAATACCGACATCGCCATCGACGCCTTGGAAATCATT
GGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTGGACGCTCTGCTCGACGCC
GATCTCATCGGTCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAGGCCGATGAAGCCGACCGAAACGGCGTCTAT
TACGCTCTCGGTATCGTCGAGAATCTCTGCTCACGCTCGGCCACGGCCGCTCGCATCGGCGCTCACGACGCCCTT
CTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAGAACAAGCAATACGCGGCC
GAGATTCTCGCCATCCTCTCCCAGTCCGCGGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATCGACATC
ATGCTACAGCTCGTCGCCGCATACCGCAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATGGAGAAC
CTCTTCGAAGCCCTCACCTGCCTCGTCGACGAGCCATCGGGAAAGGCCAAGTTCATCGAGGCCGAGGGCGTCGAG
CTCTGCCTCATCATGTTCAGGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTCCGCCTGATGGACCACGCCACGGGC
GGCGCTTCGACCGCTGCCGTAGATGTGTGCGTCAAGATCGTCGACGCCGGCGGCCTGCGCCCCCTGTTCACCCTC
TTCATCAAGAGCCGCGATCGGCGCCTGCAGGGCCACATGCTCGGTGTGCTGGCGTCGATGATGCGCCTGCTGCCG
GCCGGTTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAACTTGTG
CAGCTTCATGCCGACTTTGGCGCTCTCGTCAGGCGTGCCGAGGCTCAGCATCGTCGGGACGCCGCGGGGGTGGAC
CCGACCGAGGCAGAGGTCGAGCTGCTGTCGCGGAGGCTCGATGCTGGGCTCTTCGCCCTGCAGCAGGTGGATGTC
TTGCTGGCCTGGTTGGCGGCCGAGGACGGCGGAGCGAGGAAACGGATCGAGCGGCTGCTGGGAGACCGGGATGAG
AGCTTTGCTACTGTGGCGGCCATCATCAAGGAGCAGCGGGAGGGTTTAGATACCACGGAGGAGGACAGCAAGGAT
ATGAGCGACATGTTAGATACACTGCTGGAGTTTGTGCGGTAG
Gene >Ophun1|1346
ATGGCGAGCGTCGACGACATCTTCAAGGTTCGTCAAACTCTCGTGTGCATCTGTCTATTCCTCTGTCTCTTTAAC
TGGCTGATCTGATGTCGCCGCACAGAACGTCGGCCTGCCCAGCAAGCGAAAACGAGAAGCCATCGCCGATCCGAG
TCCGTCCACATTCGCCTCCCCCAATATCTCCAAAGAGCCTCTCTCGCTAACGCGGGTGAATCATCTCTCTTCTCA
GACGAACTCTATAAATCGAGCAAACTCACCGCCTCAAGCCACCGAACTCGCAACGAAGCCGAGGCTGATGCCACT
GTTGCCGAAGACGATGACGAGCTCGAAGCCGGTCCCGCGCCACCGCCGCAGCAGGGAGAGGCAGACGAAGAAGGC
GACGATGACGAAGGCCGCTTCTTCGGCGGCGGCATCTCGGCGAAAGAGTCCGAGGTGCTCGACTTCGTAGCCGGC
GCAGGCGAGGACGCAGACCGAGGCCCCGAAAAGATTGACGTCGCCTGGATGCGCAGGACGGCTCAGACGCTGGAA
AAGCGCATCGCGACAAACACGCGACTCCGCGCCAAGTTCGAGGGCGATCCGCAAAAGTTCATCGCCAGCGAAGCC
GAGCTCGACGCCGACGTCAAAGCCTTGTCGATTCTTTCTGAACACCCGGAGCTGTATCCCGACTTTGTCGTCCTC
GGCTGCGCCGTCCATCTCGTCGGTCTCCTCGCTCACGACAATACCGACATCGCCATCGACGCCTTGGAAATCATT
GGCGAGCTGACGGACGAGGACGTCGCCGCCGACGACAGCCAGTGGGACGCTTTGGTGGACGCTCTGCTCGACGCC
GATCTCATCGGTCTGCTCGTCTCCAACCTGGCTCGCCTAGACGAGGCCGATGAAGCCGACCGAAACGGCGTCTAT
TACGCTCTCGGTATCGTCGAGAATCTCTGCTCACGCTCGGCCACGGCCGCTCGCATCGGCGCTCACGACGCCCTT
CTCGGCTGGCTGCTACAGCGCATCCAACGCCAGGAGCAGCCTATAACCGTCTCCCAGAACAAGCAATACGCGGCC
GAGATTCTCGCCATCCTCTCCCAGTCCGCGGCCGAGATCCGCCGCCAGATGGCCGCCCGCGACGCCATCGACATC
ATGCTACAGCTCGTCGCCGCATACCGCAAACGCGACCCGGACAAGGGCGGCGAGGAGGAAGAGTACATGGAGAAC
CTCTTCGAAGCCCTCACCTGCCTCGTCGACGAGCCATCGGGAAAGGCCAAGTTCATCGAGGCCGAGGGCGTCGAG
CTCTGCCTCATCATGTTCAGGGAGGGCAAGCGCAGCAAAGCCCCGGCCCTCCGCCTGATGGACCACGCCACGGGC
GGCGCTTCGACCGCTGCCGTAGATGTGTGCGTCAAGATCGTCGACGCCGGCGGCCTGCGCCCCCTGTTCACCCTC
TTCATCAAGAGCCGCGATCGGCGCCTGCAGGGCCACATGCTCGGTGTGCTGGCGTCGATGATGCGCCTGCTGCCG
GCCGGTTCGGCCGAGAGGATCCGCACGCTGGCCAAGTTCGTGGAGAAGGACTACGAGAAGACGGCCAAACTTGTG
CAGCTTCATGCCGACTTTGGCGCTCTCGTCAGGCGTGCCGAGGCTCAGCATCGTCGGGACGCCGCGGGGGTGGAC
CCGACCGAGGCAGAGGTCGAGCTGCTGTCGCGGAGGCTCGATGCTGGGCTCTTCGCCCTGCAGCAGGTGGATGTC
TTGCTGGCCTGGTTGGCGGCCGAGGACGGCGGAGCGAGGAAACGGATCGAGCGGCTGCTGGGAGACCGGGATGAG
AGCTTTGCTACTGTGGCGGCCATCATCAAGGAGCAGCGGGAGGGTTTAGATACCACGGAGGAGGACAGCAAGGAT
ATGAGCGACATGTTAGATACACTGCTGGAGTTTGTGCGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail