Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|134
Gene name
LocationContig_101:31491..34260
Strand+
Gene length (bp)2769
Transcript length (bp)2538
Coding sequence length (bp)2538
Protein length (aa) 846

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04841 Vps16_N Vps16, N-terminal region 7.2E-84 8 428
PF04840 Vps16_C Vps16, C-terminal region 1.7E-77 521 823

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT38|VPS16_SCHPO Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps16 PE=3 SV=1 9 813 2.0E-164
sp|Q55C58|VPS16_DICDI Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum GN=vps16 PE=3 SV=2 8 814 7.0E-143
sp|Q920Q4|VPS16_MOUSE Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus GN=Vps16 PE=1 SV=3 8 815 2.0E-133
sp|Q9H269|VPS16_HUMAN Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens GN=VPS16 PE=1 SV=2 8 815 1.0E-130
sp|Q5E9L7|VPS16_BOVIN Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus GN=VPS16 PE=2 SV=1 8 815 4.0E-127
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT38|VPS16_SCHPO Probable vacuolar protein sorting-associated protein 16 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps16 PE=3 SV=1 9 813 2.0E-164
sp|Q55C58|VPS16_DICDI Vacuolar protein sorting-associated protein 16 homolog OS=Dictyostelium discoideum GN=vps16 PE=3 SV=2 8 814 7.0E-143
sp|Q920Q4|VPS16_MOUSE Vacuolar protein sorting-associated protein 16 homolog OS=Mus musculus GN=Vps16 PE=1 SV=3 8 815 2.0E-133
sp|Q9H269|VPS16_HUMAN Vacuolar protein sorting-associated protein 16 homolog OS=Homo sapiens GN=VPS16 PE=1 SV=2 8 815 1.0E-130
sp|Q5E9L7|VPS16_BOVIN Vacuolar protein sorting-associated protein 16 homolog OS=Bos taurus GN=VPS16 PE=2 SV=1 8 815 4.0E-127
sp|Q93VQ0|VCL1_ARATH Protein VACUOLELESS1 OS=Arabidopsis thaliana GN=VCL1 PE=1 SV=1 1 814 1.0E-122
sp|Q03308|VPS16_YEAST Vacuolar protein sorting-associated protein 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS16 PE=1 SV=2 210 819 2.0E-59
sp|Q60V75|VPS16_CAEBR Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis briggsae GN=vps-16 PE=3 SV=1 13 786 4.0E-23
sp|Q11182|VPS16_CAEEL Vacuolar protein sorting-associated protein 16 homolog OS=Caenorhabditis elegans GN=vps-16 PE=3 SV=2 13 786 2.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0005737 cytoplasm Yes
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0033036 macromolecule localization No
GO:0051179 localization No
GO:0071702 organic substance transport No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5754
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1257
Ophiocordyceps australis map64 (Brazil) OphauB2|5759
Ophiocordyceps camponoti-floridani Ophcf2|05992
Ophiocordyceps camponoti-rufipedis Ophun1|134 (this protein)
Ophiocordyceps kimflemingae Ophio5|5682
Ophiocordyceps subramaniannii Hirsu2|9280

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|134
MDSLHARADWESVGDKWFRKTQQYTAVFDQDLDLDNYIVAGAPYAGALALWRDDSKLQALQPGAWTKPSIDIYSL
AGKKLRGIPWDNTSVRGLGWSEDESLLVVTADGNVRCYDLQGDFSNFSLGHGADNYGVESCRYGFTFLQGVSEYR
SLRLSFYDNGMVALLGNNSLVAVSSYAEPRPKLLATCPSGEIHSWAIVSPDHTLSRSVEVLLNIGSTVYVVDATD
CEDRLLDMGPFSHISVSPDGRYVNLYGTNGKAHVISSDFQEKLLEHNSGSHTPPKYVEWCGADALVAWEDEVHII
GPGEQSTTFIYESTRVHVVSEHDGARLITNDFCEFVERVPSDTLEVLGPASESSPASILLDAVGQLDRESPKADD
YIQLIRPSLTEAVDTCVNAAGREFDTRWQKRLLRAASFGKSVLDMYNSDEFVDMCETLRVLNAVRGYETGMPLSY
EQYHRLTPERLIRRLLQRHDYLLALKMAGHLKLPTDRIYVHWASSKVRAGSEDDETICRLVVSRLSGKPGISFEE
IARAAYHEGRARLATELLNHEPRGGRQVPLLLDMEEDELALDKAISSGDTDLMLMVLMQLKKKLPLAAFFRAINT
RPTATAMVEAAAVREGDNALLKDLYYQDDRRVDGANVFVREALRQPDARTASDKLALAAKLLSDAKESGPETQAL
REAMSLLRTQSMLGRDLGDSFTGLSVNETLFKLIRLGFNGQAKRVQGELKVPDRVAWWIRLRALVAKRDWTEIEE
IAKAKKSAIGWEPFFNLTLQAGNPRLASVFIAKCTGLAPGESVVMYEKCGMRTQAAAEAVRLKDEEGWKRQLEAA
GRTSQEGREIERLGQGVFRG*
Coding >Ophun1|134
ATGGACTCTCTCCACGCCAGAGCCGACTGGGAGAGCGTCGGAGACAAGTGGTTCCGCAAGACGCAGCAATACACA
GCCGTCTTCGACCAGGACCTCGATCTCGACAACTACATCGTCGCCGGAGCTCCTTATGCCGGCGCTCTCGCTCTA
TGGCGCGACGACAGCAAGCTGCAGGCTCTCCAGCCCGGCGCCTGGACCAAGCCGTCCATCGACATCTACAGCCTG
GCTGGCAAGAAGCTGCGCGGAATCCCCTGGGACAACACGTCGGTCCGGGGTCTGGGCTGGTCCGAGGACGAGTCG
CTGCTGGTGGTGACGGCAGACGGAAATGTGCGATGTTACGATCTTCAGGGCGACTTTAGCAACTTTTCGCTTGGT
CACGGCGCTGACAACTATGGCGTCGAGTCCTGCCGGTACGGCTTCACTTTTCTACAGGGAGTTTCCGAGTATCGC
TCACTACGTCTCAGCTTCTACGATAACGGCATGGTGGCTCTCTTGGGCAACAACTCGCTCGTCGCCGTCTCGTCG
TACGCCGAGCCCCGTCCGAAGCTCCTGGCGACCTGCCCTTCCGGTGAGATTCACTCGTGGGCCATCGTCTCGCCC
GATCATACACTGTCACGATCAGTCGAGGTGCTGCTAAACATTGGCTCGACCGTCTACGTCGTCGACGCCACCGAC
TGCGAGGACCGCCTGCTCGACATGGGCCCCTTTAGCCACATCAGCGTGTCGCCCGACGGGCGGTACGTGAACCTG
TATGGGACCAACGGCAAGGCCCATGTGATATCCAGCGACTTTCAAGAGAAGCTGCTGGAGCACAACTCGGGTTCT
CACACGCCTCCCAAGTATGTCGAGTGGTGCGGCGCCGATGCGCTCGTCGCGTGGGAGGACGAGGTGCACATCATC
GGGCCGGGCGAGCAGTCGACGACGTTTATATACGAGAGCACCCGCGTTCACGTCGTATCTGAACACGACGGGGCC
CGGCTCATCACAAACGACTTTTGCGAGTTCGTCGAGAGAGTTCCCAGCGACACGCTCGAGGTGCTCGGTCCAGCG
TCAGAGTCGTCGCCGGCATCGATCCTACTCGACGCCGTCGGCCAGCTGGACCGCGAGTCTCCCAAGGCAGACGAC
TACATCCAGCTGATCCGGCCCAGTCTGACCGAGGCTGTCGACACCTGCGTCAACGCGGCGGGTCGTGAGTTCGAT
ACGCGGTGGCAGAAGCGGCTGCTGCGGGCGGCATCGTTTGGCAAGTCGGTGCTGGACATGTACAACAGCGACGAG
TTTGTCGACATGTGCGAGACGCTACGGGTTCTCAACGCGGTCCGAGGCTACGAGACGGGCATGCCGCTGTCGTAC
GAGCAGTACCACCGGCTGACGCCCGAGAGACTGATTCGGCGACTGCTCCAGAGGCACGACTACCTGCTGGCCCTC
AAGATGGCCGGCCACCTCAAGCTGCCGACGGACCGCATCTACGTCCATTGGGCCTCGTCCAAGGTCAGGGCCGGT
AGCGAGGACGATGAGACCATCTGCCGGCTGGTAGTGTCGCGGCTATCGGGCAAGCCGGGCATCTCGTTTGAGGAG
ATTGCGCGAGCCGCCTACCACGAGGGCAGGGCGCGACTGGCGACGGAGCTGCTGAACCACGAGCCGCGAGGGGGT
CGGCAGGTGCCGCTGCTGCTGGACATGGAGGAGGACGAGCTGGCGCTGGACAAGGCCATCTCGAGCGGCGATACG
GACCTGATGCTCATGGTGCTGATGCAGCTGAAGAAGAAGCTCCCGCTGGCCGCCTTCTTCCGGGCCATCAATACG
CGACCGACGGCGACGGCCATGGTTGAGGCGGCGGCGGTACGCGAGGGCGACAACGCGCTGCTCAAGGACCTTTAC
TACCAAGACGATCGACGGGTCGACGGCGCCAACGTCTTCGTGCGAGAAGCCCTGCGACAACCGGACGCGCGGACG
GCATCGGACAAGCTGGCGCTGGCGGCCAAGCTGCTGTCGGACGCCAAGGAGTCAGGGCCGGAGACTCAGGCGCTG
CGCGAGGCCATGAGCCTGCTGCGGACGCAGTCGATGCTGGGCCGCGACCTGGGCGACTCGTTTACGGGGCTGAGC
GTCAACGAGACACTCTTTAAGCTGATACGGCTGGGCTTCAACGGGCAGGCCAAGAGGGTTCAGGGCGAGCTCAAG
GTGCCGGACAGGGTGGCGTGGTGGATAAGGCTGCGGGCGCTGGTGGCCAAGAGGGACTGGACGGAGATTGAGGAG
ATTGCCAAGGCGAAGAAGAGCGCGATTGGGTGGGAGCCCTTTTTCAACCTGACTCTGCAGGCGGGCAACCCGCGG
CTGGCGAGCGTCTTCATCGCAAAGTGCACGGGCCTGGCTCCGGGCGAGAGCGTCGTCATGTACGAAAAGTGCGGG
ATGCGGACGCAGGCGGCGGCCGAGGCGGTGCGGCTCAAGGACGAGGAGGGATGGAAGAGGCAGCTGGAGGCGGCG
GGTCGGACATCGCAGGAGGGACGGGAGATTGAGAGGCTGGGACAGGGTGTGTTCCGGGGATGA
Transcript >Ophun1|134
ATGGACTCTCTCCACGCCAGAGCCGACTGGGAGAGCGTCGGAGACAAGTGGTTCCGCAAGACGCAGCAATACACA
GCCGTCTTCGACCAGGACCTCGATCTCGACAACTACATCGTCGCCGGAGCTCCTTATGCCGGCGCTCTCGCTCTA
TGGCGCGACGACAGCAAGCTGCAGGCTCTCCAGCCCGGCGCCTGGACCAAGCCGTCCATCGACATCTACAGCCTG
GCTGGCAAGAAGCTGCGCGGAATCCCCTGGGACAACACGTCGGTCCGGGGTCTGGGCTGGTCCGAGGACGAGTCG
CTGCTGGTGGTGACGGCAGACGGAAATGTGCGATGTTACGATCTTCAGGGCGACTTTAGCAACTTTTCGCTTGGT
CACGGCGCTGACAACTATGGCGTCGAGTCCTGCCGGTACGGCTTCACTTTTCTACAGGGAGTTTCCGAGTATCGC
TCACTACGTCTCAGCTTCTACGATAACGGCATGGTGGCTCTCTTGGGCAACAACTCGCTCGTCGCCGTCTCGTCG
TACGCCGAGCCCCGTCCGAAGCTCCTGGCGACCTGCCCTTCCGGTGAGATTCACTCGTGGGCCATCGTCTCGCCC
GATCATACACTGTCACGATCAGTCGAGGTGCTGCTAAACATTGGCTCGACCGTCTACGTCGTCGACGCCACCGAC
TGCGAGGACCGCCTGCTCGACATGGGCCCCTTTAGCCACATCAGCGTGTCGCCCGACGGGCGGTACGTGAACCTG
TATGGGACCAACGGCAAGGCCCATGTGATATCCAGCGACTTTCAAGAGAAGCTGCTGGAGCACAACTCGGGTTCT
CACACGCCTCCCAAGTATGTCGAGTGGTGCGGCGCCGATGCGCTCGTCGCGTGGGAGGACGAGGTGCACATCATC
GGGCCGGGCGAGCAGTCGACGACGTTTATATACGAGAGCACCCGCGTTCACGTCGTATCTGAACACGACGGGGCC
CGGCTCATCACAAACGACTTTTGCGAGTTCGTCGAGAGAGTTCCCAGCGACACGCTCGAGGTGCTCGGTCCAGCG
TCAGAGTCGTCGCCGGCATCGATCCTACTCGACGCCGTCGGCCAGCTGGACCGCGAGTCTCCCAAGGCAGACGAC
TACATCCAGCTGATCCGGCCCAGTCTGACCGAGGCTGTCGACACCTGCGTCAACGCGGCGGGTCGTGAGTTCGAT
ACGCGGTGGCAGAAGCGGCTGCTGCGGGCGGCATCGTTTGGCAAGTCGGTGCTGGACATGTACAACAGCGACGAG
TTTGTCGACATGTGCGAGACGCTACGGGTTCTCAACGCGGTCCGAGGCTACGAGACGGGCATGCCGCTGTCGTAC
GAGCAGTACCACCGGCTGACGCCCGAGAGACTGATTCGGCGACTGCTCCAGAGGCACGACTACCTGCTGGCCCTC
AAGATGGCCGGCCACCTCAAGCTGCCGACGGACCGCATCTACGTCCATTGGGCCTCGTCCAAGGTCAGGGCCGGT
AGCGAGGACGATGAGACCATCTGCCGGCTGGTAGTGTCGCGGCTATCGGGCAAGCCGGGCATCTCGTTTGAGGAG
ATTGCGCGAGCCGCCTACCACGAGGGCAGGGCGCGACTGGCGACGGAGCTGCTGAACCACGAGCCGCGAGGGGGT
CGGCAGGTGCCGCTGCTGCTGGACATGGAGGAGGACGAGCTGGCGCTGGACAAGGCCATCTCGAGCGGCGATACG
GACCTGATGCTCATGGTGCTGATGCAGCTGAAGAAGAAGCTCCCGCTGGCCGCCTTCTTCCGGGCCATCAATACG
CGACCGACGGCGACGGCCATGGTTGAGGCGGCGGCGGTACGCGAGGGCGACAACGCGCTGCTCAAGGACCTTTAC
TACCAAGACGATCGACGGGTCGACGGCGCCAACGTCTTCGTGCGAGAAGCCCTGCGACAACCGGACGCGCGGACG
GCATCGGACAAGCTGGCGCTGGCGGCCAAGCTGCTGTCGGACGCCAAGGAGTCAGGGCCGGAGACTCAGGCGCTG
CGCGAGGCCATGAGCCTGCTGCGGACGCAGTCGATGCTGGGCCGCGACCTGGGCGACTCGTTTACGGGGCTGAGC
GTCAACGAGACACTCTTTAAGCTGATACGGCTGGGCTTCAACGGGCAGGCCAAGAGGGTTCAGGGCGAGCTCAAG
GTGCCGGACAGGGTGGCGTGGTGGATAAGGCTGCGGGCGCTGGTGGCCAAGAGGGACTGGACGGAGATTGAGGAG
ATTGCCAAGGCGAAGAAGAGCGCGATTGGGTGGGAGCCCTTTTTCAACCTGACTCTGCAGGCGGGCAACCCGCGG
CTGGCGAGCGTCTTCATCGCAAAGTGCACGGGCCTGGCTCCGGGCGAGAGCGTCGTCATGTACGAAAAGTGCGGG
ATGCGGACGCAGGCGGCGGCCGAGGCGGTGCGGCTCAAGGACGAGGAGGGATGGAAGAGGCAGCTGGAGGCGGCG
GGTCGGACATCGCAGGAGGGACGGGAGATTGAGAGGCTGGGACAGGGTGTGTTCCGGGGATGA
Gene >Ophun1|134
ATGGACTCTCTCCACGCCAGAGCCGACTGGGAGAGCGTCGGAGACAAGTGGTTCCGCAAGACGCAGCAATACACA
GCCGTCTTCGACCAGGACCTCGATCTCGACAACTACATCGTCGCCGGAGCTCCTTATGCCGGCGCTCTCGGTGAG
GATGGTCTCCTCGTCCTCCCGAGCCAGCCGCGGCTGATGGTCTACCCTCAGCTCTATGGCGCGACGACAGCAAGC
TGCAGGCTCTCCAGCCCGGCGCCTGGACCAAGCCGTCCATCGACATCTACAGCCTGGCTGGCAAGAAGCTGCGCG
GAATCCCCTGGGACAACACGTCGGTCCGGGGTCTGGGCTGGTCCGAGGACGAGTCGCTGCTGGTGGTGACGGCAG
ACGGAAATGTGCGATGTTACGATCTTCAGGGCGACTTTAGCAACTTTTCGCTTGGTCACGGCGCTGACAACTATG
GCGTCGAGTCCTGCCGGTACGGCTTCACTTTTCTACAGGGAGTTTCCGAGTATCGCTCACTACGTCTCAGCTTCT
ACGATAACGGCATGGTGGCTCTCTTGGGCAACAACTCGCTCGTCGCCGTCTCGTCGTACGCCGAGCCCCGTCCGA
AGCTCCTGGCGACCTGCCCTTCCGGTGAGATTCACTCGTGGGCCATCGTCTCGCCCGATCATACACTGTCACGAT
CAGTCGAGGTGCTGCTAAACATTGGCTCGACCGTCTACGTCGTCGACGCCACCGACTGCGAGGACCGCCTGCTCG
ACATGGGCCCCTTTAGCCACATCAGCGTGTCGCCCGACGGGCGGTACGTGAACCTGTATGGGACCAACGGCAAGG
CCCATGTGATATCCAGCGACTTTCAAGAGAAGCTGCTGGAGCACAACTCGGGTTCTCACACGCCTCCCAAGTATG
TCGAGTGGTGCGGCGCCGATGCGCTCGTCGCGTGGGAGGACGAGGTGCACATCATCGGGCCGGGCGAGCAGTCGA
CGACGTTTATATACGAGAGCACCCGCGTTCACGTCGTATCTGGTACGCGTTGCTCCTTTTGGCCGAGCGAGGTGT
TACTGATCGATGCCCTTTTCTCAGAACACGACGGGGCCCGGCTCATCACAAACGACTTTTGCGAGTTCGTCGAGA
GAGTTCCCAGCGACACGCTCGAGGTGCTCGGTCCAGCGTCAGAGTCGTCGCCGGCATCGATCCTACTCGACGCCG
TCGGCCAGCTGGACCGCGAGTCTCCCAAGGCAGACGACTACATCCAGCTGATCCGGCCCAGTCTGACCGAGGCTG
TCGACACCTGCGTCAACGCGGCGGGTCGTGAGTTCGATACGCGGTGGCAGAAGCGGCTGCTGCGGGCGGCATCGT
TTGGCAAGTCGGTGCTGGACATGTACAACAGCGACGAGTTTGTCGACATGTGCGAGACGCTACGGGTTCTCAACG
CGGTCCGAGGCTACGAGACGGGCATGCCGCTGTCGTACGAGCAGTACCACCGGCTGACGCCCGAGAGACTGATTC
GGCGACTGCTCCAGAGGCACGACTACCTGCTGGCCCTCAAGATGGCCGGCCACCTCAAGCTGCCGACGGACCGCA
TCTACGTCCATTGGGCCTCGTCCAAGGTCAGGGCCGGTAGCGAGGACGATGAGACCATCTGCCGGCTGGTAGTGT
CGCGGCTATCGGGCAAGCCGGGCATCTCGTTTGAGGAGATTGCGCGAGCCGCCTACCACGAGGGCAGGGCGCGAC
TGGCGACGGAGCTGCTGAACCACGAGCCGCGAGGGGGTCGGCAGGTGCCGCTGCTGCTGGACATGGAGGAGGACG
AGCTGGCGCTGGACAAGGCCATCTCGAGCGGCGATACGGACCTGATGCTCATGGTGCTGATGCAGCTGAAGAAGA
AGCTCCCGCTGGCCGCCTTCTTCCGGGCCATCAATACGCGACCGACGGCGACGGCCATGGTTGAGGCGGCGGCGG
TACGCGAGGGCGACAACGCGCTGCTCAAGGACCTTTACTACCAAGACGATCGACGGGTCGACGGCGCCAACGTCT
TCGTGCGAGAAGCCCTGCGACAACCGGACGCGCGGACGGCATCGGACAAGCTGGCGCTGGCGGCCAAGCTGCTGT
CGGACGCCAAGGAGTCAGGGCCGGAGACTCAGGCGCTGCGCGAGGCCATGAGCCTGCTGCGGACGCAGTCGATGC
TGGGCCGCGACCTGGGCGACTCGTTTACGGGGCTGAGCGTCAACGAGACACTCTTTAAGCTGATACGGCTGGGCT
TCAACGGGCAGGCCAAGAGGGTTCAGGGCGAGCTCAAGGTGCCGGACAGGGTGGCGTGGTGGATAAGGTGAGTTG
CCGGGACAGTGAGACTCGTGAGCCAGATGCTGAGACGTTGGGGATCTTTGCAGGCTGCGGGCGCTGGTGGCCAAG
AGGGACTGGACGGAGATTGAGGAGATTGCCAAGGCGAAGAAGAGCGCGATTGGGTGGGAGGTGAGCGTCCCTCTC
CGCTGAAACAAGGAGAGAGAGAAGAGGCTAACCAGCAGTCAGCCCTTTTTCAACCTGACTCTGCAGGCGGGCAAC
CCGCGGCTGGCGAGCGTCTTCATCGCAAAGTGCACGGGCCTGGCTCCGGGCGAGAGCGTCGTCATGTACGAAAAG
TGCGGGATGCGGACGCAGGCGGCGGCCGAGGCGGTGCGGCTCAAGGACGAGGAGGGATGGAAGAGGCAGCTGGAG
GCGGCGGGTCGGACATCGCAGGAGGGACGGGAGATTGAGAGGCTGGGACAGGGTGTGTTCCGGGGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail