Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1337
Gene name
LocationContig_1528:791..1841
Strand+
Gene length (bp)1050
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34024|PLC_LISMO 1-phosphatidylinositol phosphodiesterase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=plcA PE=1 SV=1 59 333 2.0E-31
sp|P08954|PLC_BACTU 1-phosphatidylinositol phosphodiesterase OS=Bacillus thuringiensis PE=1 SV=1 59 217 4.0E-13
sp|P14262|PLC_BACCE 1-phosphatidylinositol phosphodiesterase OS=Bacillus cereus PE=1 SV=1 59 338 3.0E-11
sp|Q0VAA5|PLCX2_HUMAN PI-PLC X domain-containing protein 2 OS=Homo sapiens GN=PLCXD2 PE=2 SV=1 59 154 3.0E-10
sp|Q2G1Q2|PLC_STAA8 1-phosphatidylinositol phosphodiesterase OS=Staphylococcus aureus (strain NCTC 8325) GN=plc PE=1 SV=1 13 208 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34024|PLC_LISMO 1-phosphatidylinositol phosphodiesterase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=plcA PE=1 SV=1 59 333 2.0E-31
sp|P08954|PLC_BACTU 1-phosphatidylinositol phosphodiesterase OS=Bacillus thuringiensis PE=1 SV=1 59 217 4.0E-13
sp|P14262|PLC_BACCE 1-phosphatidylinositol phosphodiesterase OS=Bacillus cereus PE=1 SV=1 59 338 3.0E-11
sp|Q0VAA5|PLCX2_HUMAN PI-PLC X domain-containing protein 2 OS=Homo sapiens GN=PLCXD2 PE=2 SV=1 59 154 3.0E-10
sp|Q2G1Q2|PLC_STAA8 1-phosphatidylinositol phosphodiesterase OS=Staphylococcus aureus (strain NCTC 8325) GN=plc PE=1 SV=1 13 208 2.0E-07
sp|P45723|PLC_STAAE 1-phosphatidylinositol phosphodiesterase OS=Staphylococcus aureus (strain Newman) GN=plc PE=1 SV=2 34 208 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.5

Transmembrane Domains

Domain # Start End Length
1 12 29 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1337
MMTQNLSKAKILLPACILTALILSLIHLHRTPPHAFFARTTPSRSPYSFNADASHRPAWMASIPDDTPLSSLSIP
GTHDTMTSRLSWIPHLWCQNLPLQSQLEAGVRYLDIRLVLRDGELAIYHYPGDTGYLFPDALRIMDSFLAAHPSE
TLVVRVKDEGHPLGDNDGTDFASAFARDVRSSNRVHAYDPGDPLPILGHLRGSIFLLQEFKASTRYGLEWNGTYM
ALEDWWVVPDLASLPIKWDKIRDALEQAATKNDELLYLAHISATGLQLRPVDAAAGPKDGSATGLNDQTGRWLED
ECGSGRFARERVGVVILDFPGKRAVDAVLAWNEALRVSGGKGCELRGDV*
Coding >Ophun1|1337
ATGATGACCCAAAACCTCTCCAAAGCAAAGATCCTCCTCCCCGCCTGCATCCTCACTGCCCTCATCCTCTCCCTC
ATCCACCTCCACAGAACCCCCCCCCACGCCTTCTTCGCCCGCACCACTCCCTCCCGCAGCCCCTACAGCTTCAAC
GCCGATGCCTCCCACCGTCCAGCATGGATGGCCTCCATCCCAGACGACACGCCCCTCTCCAGCCTCAGCATCCCC
GGCACCCACGACACCATGACCTCGCGCCTGAGCTGGATCCCCCATCTCTGGTGTCAGAACCTGCCGCTCCAGTCC
CAGCTCGAAGCCGGAGTCCGCTACCTCGACATCCGCCTCGTCCTCCGCGACGGCGAGCTCGCCATCTATCACTAC
CCCGGTGACACGGGCTACCTCTTCCCCGACGCCCTGCGCATAATGGACAGCTTCCTCGCCGCCCACCCTTCCGAG
ACGCTCGTCGTCCGCGTCAAGGACGAAGGACACCCCCTCGGCGACAACGACGGCACCGACTTTGCCTCTGCCTTT
GCCCGGGATGTCCGCTCCAGCAACCGCGTACACGCCTACGACCCCGGCGATCCGCTCCCCATCCTCGGCCACCTC
CGCGGCTCCATCTTCCTGCTGCAAGAGTTCAAGGCCAGCACGCGCTACGGCCTCGAATGGAACGGGACCTACATG
GCCCTCGAAGACTGGTGGGTGGTTCCGGACCTCGCCTCCCTCCCGATAAAATGGGATAAGATCCGGGACGCGCTC
GAGCAGGCTGCCACCAAGAACGATGAGCTGCTATACCTGGCGCACATTTCGGCGACGGGCCTCCAGCTGCGGCCC
GTCGACGCGGCAGCCGGTCCCAAAGACGGGTCGGCGACGGGACTCAACGACCAGACGGGCCGCTGGCTGGAAGAC
GAGTGCGGGAGCGGACGGTTTGCGAGGGAGAGGGTTGGGGTCGTCATCTTGGACTTTCCGGGGAAGAGGGCTGTT
GATGCGGTGCTGGCGTGGAATGAGGCGTTGCGGGTGTCGGGGGGGAAGGGCTGTGAGTTGCGGGGGGATGTTTGA
Transcript >Ophun1|1337
ATGATGACCCAAAACCTCTCCAAAGCAAAGATCCTCCTCCCCGCCTGCATCCTCACTGCCCTCATCCTCTCCCTC
ATCCACCTCCACAGAACCCCCCCCCACGCCTTCTTCGCCCGCACCACTCCCTCCCGCAGCCCCTACAGCTTCAAC
GCCGATGCCTCCCACCGTCCAGCATGGATGGCCTCCATCCCAGACGACACGCCCCTCTCCAGCCTCAGCATCCCC
GGCACCCACGACACCATGACCTCGCGCCTGAGCTGGATCCCCCATCTCTGGTGTCAGAACCTGCCGCTCCAGTCC
CAGCTCGAAGCCGGAGTCCGCTACCTCGACATCCGCCTCGTCCTCCGCGACGGCGAGCTCGCCATCTATCACTAC
CCCGGTGACACGGGCTACCTCTTCCCCGACGCCCTGCGCATAATGGACAGCTTCCTCGCCGCCCACCCTTCCGAG
ACGCTCGTCGTCCGCGTCAAGGACGAAGGACACCCCCTCGGCGACAACGACGGCACCGACTTTGCCTCTGCCTTT
GCCCGGGATGTCCGCTCCAGCAACCGCGTACACGCCTACGACCCCGGCGATCCGCTCCCCATCCTCGGCCACCTC
CGCGGCTCCATCTTCCTGCTGCAAGAGTTCAAGGCCAGCACGCGCTACGGCCTCGAATGGAACGGGACCTACATG
GCCCTCGAAGACTGGTGGGTGGTTCCGGACCTCGCCTCCCTCCCGATAAAATGGGATAAGATCCGGGACGCGCTC
GAGCAGGCTGCCACCAAGAACGATGAGCTGCTATACCTGGCGCACATTTCGGCGACGGGCCTCCAGCTGCGGCCC
GTCGACGCGGCAGCCGGTCCCAAAGACGGGTCGGCGACGGGACTCAACGACCAGACGGGCCGCTGGCTGGAAGAC
GAGTGCGGGAGCGGACGGTTTGCGAGGGAGAGGGTTGGGGTCGTCATCTTGGACTTTCCGGGGAAGAGGGCTGTT
GATGCGGTGCTGGCGTGGAATGAGGCGTTGCGGGTGTCGGGGGGGAAGGGCTGTGAGTTGCGGGGGGATGTTTGA
Gene >Ophun1|1337
ATGATGACCCAAAACCTCTCCAAAGCAAAGATCCTCCTCCCCGCCTGCATCCTCACTGCCCTCATCCTCTCCCTC
ATCCACCTCCACAGAACCCCCCCCCACGCCTTCTTCGCCCGCACCACTCCCTCCCGCAGCCCCTACAGCTTCAAC
GCCGATGCCTCCCACCGTCCAGCATGGATGGCCTCCATCCCAGACGACACGCCCCTCTCCAGCCTCAGCATCCCC
GGCACCCACGACACCATGACCTCGCGCCTGAGCTGGATCCCCCATCTCTGGTGTCAGAACCTGCCGCTCCAGTCC
CAGCTCGAAGCCGGAGTCCGCTACCTCGACATCCGCCTCGTCCTCCGCGACGGCGAGCTCGCCATCTATCACTAC
CCCGGTGACACGGGCTACCTCTTCCCCGACGCCCTGCGCATAATGGACAGCTTCCTCGCCGCCCACCCTTCCGAG
ACGCTCGTCGTCCGCGTCAAGGACGAAGGACACCCCCTCGGCGACAACGACGGCACCGACTTTGCCTCTGCCTTT
GCCCGGGATGTCCGCTCCAGCAACCGCGTACACGCCTACGACCCCGGCGATCCGCTCCCCATCCTCGGCCACCTC
CGCGGCTCCATCTTCCTGCTGCAAGAGTTCAAGGCCAGCACGCGCTACGGCCTCGAATGGAACGGGACCTACATG
GCCCTCGAAGACTGGTGGGTGGTTCCGGACCTCGCCTCCCTCCCGATAAAATGGGATAAGATCCGGGACGCGCTC
GAGCAGGCTGCCACCAAGAACGATGAGCTGCTATACCTGGCGCACATTTCGGCGACGGGCCTCCAGCTGCGGCCC
GTCGACGCGGCAGCCGGTCCCAAAGACGGGTCGGCGACGGGACTCAACGACCAGACGGGCCGCTGGCTGGAAGAC
GAGTGCGGGAGCGGACGGTTTGCGAGGGAGAGGGTTGGGGTCGTCATCTTGGACTTTCCGGGGAAGAGGGCTGTT
GATGCGGTGCTGGCGTGGAATGAGGCGTTGCGGGTGTCGGGGGGGAAGGGCTGTGAGTTGCGGGGGGATGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail