Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1335
Gene name
LocationContig_1524:63..297
Strand-
Gene length (bp)234
Transcript length (bp)234
Coding sequence length (bp)234
Protein length (aa) 78

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7G5|PHACA_EMEND Phenylacetate 2-hydroxylase OS=Emericella nidulans GN=phacA PE=1 SV=1 10 75 1.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1335
MFHPWLVLLVAAAVAVHLVRRLLYATDVPKIKGLPEAPGLPLLGSLVHLGSDHPRVARRWADRYGPVVQARLGNR
VS*
Coding >Ophun1|1335
ATGTTCCACCCCTGGCTCGTCCTCCTGGTGGCGGCCGCAGTCGCCGTCCATCTCGTTAGGCGTCTTTTGTACGCC
ACCGATGTGCCCAAGATCAAGGGCCTGCCCGAGGCTCCGGGACTTCCGCTCCTGGGCAGCCTCGTTCATCTGGGC
TCCGACCATCCGCGGGTGGCGCGTCGATGGGCTGACCGGTACGGGCCTGTCGTCCAGGCTCGGCTGGGGAACAGG
GTTAGTTGA
Transcript >Ophun1|1335
ATGTTCCACCCCTGGCTCGTCCTCCTGGTGGCGGCCGCAGTCGCCGTCCATCTCGTTAGGCGTCTTTTGTACGCC
ACCGATGTGCCCAAGATCAAGGGCCTGCCCGAGGCTCCGGGACTTCCGCTCCTGGGCAGCCTCGTTCATCTGGGC
TCCGACCATCCGCGGGTGGCGCGTCGATGGGCTGACCGGTACGGGCCTGTCGTCCAGGCTCGGCTGGGGAACAGG
GTTAGTTGA
Gene >Ophun1|1335
ATGTTCCACCCCTGGCTCGTCCTCCTGGTGGCGGCCGCAGTCGCCGTCCATCTCGTTAGGCGTCTTTTGTACGCC
ACCGATGTGCCCAAGATCAAGGGCCTGCCCGAGGCTCCGGGACTTCCGCTCCTGGGCAGCCTCGTTCATCTGGGC
TCCGACCATCCGCGGGTGGCGCGTCGATGGGCTGACCGGTACGGGCCTGTCGTCCAGGCTCGGCTGGGGAACAGG
GTTAGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail