Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1334
Gene name
LocationContig_152:29261..31604
Strand+
Gene length (bp)2343
Transcript length (bp)2181
Coding sequence length (bp)2181
Protein length (aa) 727

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01204 Trehalase Trehalase 2.6E-188 123 686
PF07492 Trehalase_Ca-bi Neutral trehalase Ca2+ binding domain 6.2E-16 69 98

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O42783|TREB_NEUCR Neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=treB PE=2 SV=2 1 717 0.0E+00
sp|O42622|TREB_MAGO7 Neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTH1 PE=2 SV=2 4 717 0.0E+00
sp|O42777|TREB_EMENI Neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=treB PE=3 SV=2 46 706 0.0E+00
sp|O42893|TREA_SCHPO Neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntp1 PE=1 SV=1 1 719 0.0E+00
sp|P32356|TREA_YEAST Neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH1 PE=1 SV=3 46 717 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O42783|TREB_NEUCR Neutral trehalase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=treB PE=2 SV=2 1 717 0.0E+00
sp|O42622|TREB_MAGO7 Neutral trehalase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=NTH1 PE=2 SV=2 4 717 0.0E+00
sp|O42777|TREB_EMENI Neutral trehalase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=treB PE=3 SV=2 46 706 0.0E+00
sp|O42893|TREA_SCHPO Neutral trehalase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ntp1 PE=1 SV=1 1 719 0.0E+00
sp|P32356|TREA_YEAST Neutral trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH1 PE=1 SV=3 46 717 0.0E+00
sp|Q757L1|TREB_ASHGO Probable trehalase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NTH2 PE=3 SV=1 46 707 0.0E+00
sp|P52494|TREA_CANAX Neutral trehalase OS=Candida albicans GN=NTC1 PE=1 SV=1 45 706 0.0E+00
sp|P35172|TREB_YEAST Probable trehalase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NTH2 PE=1 SV=1 46 712 0.0E+00
sp|P49381|TREA_KLULA Neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTH1 PE=3 SV=1 26 698 0.0E+00
sp|Q1RCP3|TREA_ECOUT Periplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) GN=treA PE=3 SV=1 231 709 6.0E-39
sp|B7MK99|TREA_ECO45 Periplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=treA PE=3 SV=1 231 709 6.0E-39
sp|A1AAC5|TREA_ECOK1 Periplasmic trehalase OS=Escherichia coli O1:K1 / APEC GN=treA PE=3 SV=1 231 709 7.0E-39
sp|Q0T5J8|TREA_SHIF8 Periplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) GN=treA PE=3 SV=1 231 712 2.0E-38
sp|B7N408|TREA_ECOLU Periplasmic trehalase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=treA PE=3 SV=1 231 709 2.0E-38
sp|B7LXB1|TREA_ECO8A Periplasmic trehalase OS=Escherichia coli O8 (strain IAI1) GN=treA PE=3 SV=1 231 712 3.0E-38
sp|Q8CW46|TREA_ECOL6 Periplasmic trehalase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=treA PE=3 SV=1 231 709 3.0E-38
sp|Q83RP6|TREA_SHIFL Periplasmic trehalase OS=Shigella flexneri GN=treA PE=3 SV=2 231 712 3.0E-38
sp|B6I9Q8|TREA_ECOSE Periplasmic trehalase OS=Escherichia coli (strain SE11) GN=treA PE=3 SV=1 231 712 4.0E-38
sp|B1LHA4|TREA_ECOSM Periplasmic trehalase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=treA PE=3 SV=1 232 709 4.0E-38
sp|B7NUW3|TREA_ECO7I Periplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=treA PE=3 SV=1 231 709 4.0E-38
sp|Q8XDH7|TREA_ECO57 Putative periplasmic trehalase OS=Escherichia coli O157:H7 GN=treA PE=5 SV=2 231 709 7.0E-38
sp|B7LGV7|TREA_ECO55 Periplasmic trehalase OS=Escherichia coli (strain 55989 / EAEC) GN=treA PE=3 SV=1 231 712 8.0E-38
sp|P13482|TREA_ECOLI Periplasmic trehalase OS=Escherichia coli (strain K12) GN=treA PE=1 SV=1 231 712 8.0E-38
sp|B1IU96|TREA_ECOLC Periplasmic trehalase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=treA PE=3 SV=1 231 712 8.0E-38
sp|A7ZZD1|TREA_ECOHS Periplasmic trehalase OS=Escherichia coli O9:H4 (strain HS) GN=treA PE=3 SV=1 231 712 8.0E-38
sp|B1XAN8|TREA_ECODH Periplasmic trehalase OS=Escherichia coli (strain K12 / DH10B) GN=treA PE=3 SV=1 231 712 8.0E-38
sp|C4ZTN8|TREA_ECOBW Periplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=treA PE=3 SV=1 231 712 8.0E-38
sp|Q0TIH3|TREA_ECOL5 Periplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=treA PE=3 SV=1 231 709 9.0E-38
sp|Q32H09|TREA_SHIDS Periplasmic trehalase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=treA PE=3 SV=1 231 709 9.0E-38
sp|A7ZKW9|TREA_ECO24 Periplasmic trehalase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=treA PE=3 SV=1 231 712 2.0E-37
sp|B7UQ86|TREA_ECO27 Periplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=treA PE=3 SV=1 231 709 3.0E-37
sp|A8AFT6|TREA_CITK8 Periplasmic trehalase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=treA PE=3 SV=1 253 685 4.0E-36
sp|Q8ZLC8|TREF_SALTY Cytoplasmic trehalase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|C0Q162|TREF_SALPC Cytoplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B4SWF1|TREF_SALNS Cytoplasmic trehalase OS=Salmonella newport (strain SL254) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B4T8D8|TREF_SALHS Cytoplasmic trehalase OS=Salmonella heidelberg (strain SL476) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B5RGS3|TREF_SALG2 Cytoplasmic trehalase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B5R404|TREF_SALEP Cytoplasmic trehalase OS=Salmonella enteritidis PT4 (strain P125109) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B5FKM4|TREF_SALDC Cytoplasmic trehalase OS=Salmonella dublin (strain CT_02021853) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|Q57IL9|TREF_SALCH Cytoplasmic trehalase OS=Salmonella choleraesuis (strain SC-B67) GN=treF PE=3 SV=1 214 675 3.0E-35
sp|Q8Z277|TREF_SALTI Cytoplasmic trehalase OS=Salmonella typhi GN=treF PE=3 SV=1 214 675 3.0E-35
sp|B7LSZ0|TREF_ESCF3 Cytoplasmic trehalase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=treF PE=3 SV=1 232 675 7.0E-35
sp|Q9FWC1|TRE_ORYSJ Probable trehalase OS=Oryza sativa subsp. japonica GN=Os10g0521000 PE=2 SV=1 246 675 7.0E-35
sp|B5BI56|TREA_SALPK Periplasmic trehalase OS=Salmonella paratyphi A (strain AKU_12601) GN=treA PE=3 SV=1 231 685 7.0E-35
sp|Q5PI73|TREA_SALPA Periplasmic trehalase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=treA PE=3 SV=1 231 685 7.0E-35
sp|B4TXW7|TREA_SALSV Periplasmic trehalase OS=Salmonella schwarzengrund (strain CVM19633) GN=treA PE=3 SV=1 231 685 1.0E-34
sp|A9MLK7|TREF_SALAR Cytoplasmic trehalase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=treF PE=3 SV=1 214 675 3.0E-34
sp|Q0SZB4|TREF_SHIF8 Cytoplasmic trehalase OS=Shigella flexneri serotype 5b (strain 8401) GN=treF PE=3 SV=1 214 675 3.0E-34
sp|B4TZ02|TREF_SALSV Cytoplasmic trehalase OS=Salmonella schwarzengrund (strain CVM19633) GN=treF PE=3 SV=1 214 675 3.0E-34
sp|B5F9H0|TREF_SALA4 Cytoplasmic trehalase OS=Salmonella agona (strain SL483) GN=treF PE=3 SV=1 214 675 3.0E-34
sp|B7N1V9|TREF_ECO81 Cytoplasmic trehalase OS=Escherichia coli O81 (strain ED1a) GN=treF PE=3 SV=1 214 675 3.0E-34
sp|B5F4F0|TREA_SALA4 Periplasmic trehalase OS=Salmonella agona (strain SL483) GN=treA PE=3 SV=1 231 685 3.0E-34
sp|B2U4I7|TREF_SHIB3 Cytoplasmic trehalase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B1LJ63|TREF_ECOSM Cytoplasmic trehalase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B7NEG2|TREF_ECOLU Cytoplasmic trehalase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|P62601|TREF_ECOLI Cytoplasmic trehalase OS=Escherichia coli (strain K12) GN=treF PE=1 SV=1 214 675 4.0E-34
sp|B1X7X4|TREF_ECODH Cytoplasmic trehalase OS=Escherichia coli (strain K12 / DH10B) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|C4ZW66|TREF_ECOBW Cytoplasmic trehalase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B7NNF3|TREF_ECO7I Cytoplasmic trehalase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B5YVG5|TREF_ECO5E Cytoplasmic trehalase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|P62602|TREF_ECO57 Cytoplasmic trehalase OS=Escherichia coli O157:H7 GN=treF PE=3 SV=1 214 675 4.0E-34
sp|P59765|TREA_SALTI Putative periplasmic trehalase OS=Salmonella typhi GN=treA PE=5 SV=2 231 685 4.0E-34
sp|Q1R584|TREF_ECOUT Cytoplasmic trehalase OS=Escherichia coli (strain UTI89 / UPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|Q8FCI4|TREF_ECOL6 Cytoplasmic trehalase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|Q0TBT4|TREF_ECOL5 Cytoplasmic trehalase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|A1AH61|TREF_ECOK1 Cytoplasmic trehalase OS=Escherichia coli O1:K1 / APEC GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B7MEM1|TREF_ECO45 Cytoplasmic trehalase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B7UL72|TREF_ECO27 Cytoplasmic trehalase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|Q3YWJ3|TREF_SHISS Cytoplasmic trehalase OS=Shigella sonnei (strain Ss046) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|Q83PS8|TREF_SHIFL Cytoplasmic trehalase OS=Shigella flexneri GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B6I385|TREF_ECOSE Cytoplasmic trehalase OS=Escherichia coli (strain SE11) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B1J0B4|TREF_ECOLC Cytoplasmic trehalase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|A8A5X9|TREF_ECOHS Cytoplasmic trehalase OS=Escherichia coli O9:H4 (strain HS) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B7M3D0|TREF_ECO8A Cytoplasmic trehalase OS=Escherichia coli O8 (strain IAI1) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|A7ZT60|TREF_ECO24 Cytoplasmic trehalase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=treF PE=3 SV=1 214 675 4.0E-34
sp|B5R904|TREA_SALG2 Periplasmic trehalase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=treA PE=3 SV=1 231 685 5.0E-34
sp|B5R2X4|TREA_SALEP Periplasmic trehalase OS=Salmonella enteritidis PT4 (strain P125109) GN=treA PE=3 SV=1 231 685 5.0E-34
sp|B5FTN7|TREA_SALDC Periplasmic trehalase OS=Salmonella dublin (strain CT_02021853) GN=treA PE=3 SV=1 231 685 5.0E-34
sp|A9MVX4|TREA_SALPB Periplasmic trehalase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=treA PE=3 SV=1 231 685 6.0E-34
sp|Q2NYS3|TREA_XANOM Periplasmic trehalase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=treA PE=3 SV=1 253 675 6.0E-34
sp|B7L603|TREF_ECO55 Cytoplasmic trehalase OS=Escherichia coli (strain 55989 / EAEC) GN=treF PE=3 SV=1 232 675 8.0E-34
sp|Q31VA6|TREF_SHIBS Cytoplasmic trehalase OS=Shigella boydii serotype 4 (strain Sb227) GN=treF PE=3 SV=1 214 675 8.0E-34
sp|Q57NL6|TREA_SALCH Periplasmic trehalase OS=Salmonella choleraesuis (strain SC-B67) GN=treA PE=3 SV=1 231 685 2.0E-33
sp|Q8ZP20|TREA_SALTY Periplasmic trehalase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=treA PE=3 SV=1 231 685 3.0E-33
sp|C0Q337|TREA_SALPC Periplasmic trehalase OS=Salmonella paratyphi C (strain RKS4594) GN=treA PE=3 SV=1 231 685 4.0E-33
sp|B4SUI9|TREA_SALNS Periplasmic trehalase OS=Salmonella newport (strain SL254) GN=treA PE=3 SV=1 231 685 6.0E-33
sp|B0RNH1|TREA_XANCB Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain B100) GN=treA PE=3 SV=1 253 712 4.0E-32
sp|Q9I165|TREA_PSEAE Periplasmic trehalase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=treA PE=3 SV=1 253 675 2.0E-31
sp|Q8PPT1|TREA_XANAC Periplasmic trehalase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=treA PE=3 SV=1 220 675 4.0E-31
sp|Q8P519|TREA_XANCP Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=treA PE=3 SV=1 253 675 5.0E-31
sp|Q4UZ12|TREA_XANC8 Periplasmic trehalase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=treA PE=3 SV=1 253 675 5.0E-31
sp|Q8XT38|TREA_RALSO Periplasmic trehalase OS=Ralstonia solanacearum (strain GMI1000) GN=treA PE=3 SV=1 253 690 4.0E-30
sp|Q9JLT2|TREA_MOUSE Trehalase OS=Mus musculus GN=Treh PE=1 SV=1 141 675 2.0E-29
sp|Q9SU50|TRE1_ARATH Trehalase OS=Arabidopsis thaliana GN=TRE1 PE=2 SV=1 242 683 8.0E-29
sp|P19813|TREA_RABIT Trehalase OS=Oryctolagus cuniculus GN=TREH PE=1 SV=1 138 675 7.0E-28
sp|P32358|TREA_BOMMO Trehalase OS=Bombyx mori PE=1 SV=1 254 675 9.0E-26
sp|A8J4S9|TREA_APIME Trehalase OS=Apis mellifera PE=1 SV=1 253 723 9.0E-26
sp|O43280|TREA_HUMAN Trehalase OS=Homo sapiens GN=TREH PE=1 SV=2 141 675 2.0E-25
sp|Q8MMG9|TREA_PIMHY Trehalase OS=Pimpla hypochondriaca GN=tre1 PE=1 SV=1 109 688 2.0E-25
sp|P32359|TREA_TENMO Trehalase OS=Tenebrio molitor PE=2 SV=1 254 686 2.0E-22
sp|Q9W2M2|TREA_DROME Trehalase OS=Drosophila melanogaster GN=Treh PE=1 SV=1 253 690 3.0E-22
sp|Q54QZ5|TREA_DICDI Trehalase OS=Dictyostelium discoideum GN=treh PE=3 SV=1 253 683 2.0E-16
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0005991 trehalose metabolic process Yes
GO:0004555 alpha,alpha-trehalase activity Yes
GO:0005993 trehalose catabolic process Yes
GO:0005737 cytoplasm Yes
GO:0044275 cellular carbohydrate catabolic process No
GO:0046352 disaccharide catabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0005984 disaccharide metabolic process No
GO:0046872 metal ion binding No
GO:0009056 catabolic process No
GO:0016052 carbohydrate catabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:1901575 organic substance catabolic process No
GO:0044248 cellular catabolic process No
GO:0009311 oligosaccharide metabolic process No
GO:0016787 hydrolase activity No
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds No
GO:0043167 ion binding No
GO:0110165 cellular anatomical entity No
GO:0015927 trehalase activity No
GO:0009313 oligosaccharide catabolic process No
GO:0005575 cellular_component No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0043169 cation binding No
GO:0016798 hydrolase activity, acting on glycosyl bonds No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH37 2.2E-149 125 684

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1699
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|920
Ophiocordyceps australis map64 (Brazil) OphauB2|2442
Ophiocordyceps camponoti-floridani Ophcf2|00971
Ophiocordyceps camponoti-rufipedis Ophun1|1334 (this protein)
Ophiocordyceps kimflemingae Ophio5|2020
Ophiocordyceps subramaniannii Hirsu2|1489

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1334
MAHDGCGIYDDAKTYYASEERHSGIGSRTHSHTSLHRHPEAHEPFRRSSHDETTMLHGRRFLIQVDATLESLRAQ
EDTDGNMQITVEDNGPKVLALRTAGNNRFDVRGTYMLSNLLQELTLAKEYGRKQIILDEGRLNENPVDRLSRLIR
DHFWEGLTRRIDASSIELAARDPKDWTDDPRPRIYVPVGAPDQYEYYKRVAADRPDIRLDVRLLPERITPELIRD
MNEKPGLLAVAVEEEEDSDGRITLRGLPFVVPGGRFNELYGWDSYMESLGLLIDGRVDLAKSMVLNFCFCIQHYG
KILNATRSYYLGRSQPPFLTDMALRVYERIKHEPGAQEFLKRAMLAAIKEYHSVWTCEPRLDPVTGLSRYRPEGL
GVPPETEAGHFVHILEPYLAKYGMPFEELVRAYNHGDVKEPALDEYFLHDRAVRESGHDTTYRFEGICADLATID
LNSLLFKYETDIARTIRAVFNDRLVMPAEFCGGTPYRPGDVLSSAAWDRRAKRRKLMVDRLMWNESEGMFFDYDT
AKQERRTYESSTTFWAMWAGIATPKQAADMVKRALPRFEAHGGLLAGTEKSRGEVGLERPNRQWDFPYGWAPQQM
LAWTGLLRYGFSEEAERLAYKWLLMITRAFVDFNGVVVEKYDVTRSADPHRVDAEYGNQGLDFKGVAKEGFGWVN
SSYVYGLEIINAHMRRALGTLTPYPTFVKAVEQTNERALAELSLTGAGAEA*
Coding >Ophun1|1334
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCCTCCGAGGAACGGCACTCCGGCATC
GGCTCCCGAACCCATTCCCACACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCTTTTCGCCGGAGCAGCCAT
GACGAGACGACGATGCTGCACGGCCGACGCTTCCTGATCCAGGTCGACGCCACTCTCGAGAGCCTTCGTGCCCAG
GAGGATACCGATGGCAACATGCAGATAACGGTCGAGGACAACGGCCCCAAGGTCCTGGCCCTTCGTACCGCCGGC
AACAACCGCTTCGACGTCCGCGGCACCTACATGCTGTCCAACCTGCTTCAGGAGTTGACGCTGGCCAAGGAGTAC
GGCCGCAAGCAGATCATCCTCGACGAGGGCCGCCTCAACGAGAACCCCGTCGACCGCCTGTCCCGCCTGATCCGC
GACCACTTCTGGGAGGGCCTCACCAGGCGCATCGACGCCTCCTCTATCGAGCTGGCGGCCCGCGACCCCAAGGAC
TGGACCGACGACCCTCGCCCCCGCATCTACGTCCCCGTCGGCGCTCCGGATCAGTACGAATATTACAAGCGCGTC
GCTGCCGATCGGCCAGATATCCGCCTCGACGTCCGCCTGCTGCCCGAACGCATCACGCCCGAGCTGATCCGTGAC
ATGAACGAGAAGCCGGGCCTGCTGGCTGTGGCCGTCGAGGAGGAAGAGGACTCTGACGGACGGATAACGCTCCGT
GGTCTGCCGTTTGTCGTCCCCGGTGGCCGCTTCAACGAGCTCTATGGCTGGGACAGCTATATGGAGTCGCTTGGC
CTCCTCATCGACGGGCGCGTCGACCTGGCCAAGTCAATGGTGCTCAACTTTTGCTTCTGCATACAGCACTACGGT
AAGATTCTCAACGCCACTAGATCTTACTACCTGGGCCGTTCTCAGCCGCCCTTCCTGACCGACATGGCCCTCCGC
GTCTACGAGCGCATCAAACACGAGCCCGGCGCACAAGAATTCCTCAAGCGCGCCATGTTAGCCGCCATCAAGGAG
TATCACAGCGTCTGGACGTGCGAGCCGCGTCTGGATCCCGTCACGGGCCTATCGCGGTACCGTCCCGAGGGCCTC
GGCGTGCCGCCCGAGACCGAAGCCGGCCATTTTGTGCACATCCTGGAGCCATACCTGGCCAAGTACGGAATGCCG
TTCGAGGAGCTGGTGCGTGCCTACAATCACGGCGACGTCAAGGAGCCTGCTCTTGATGAGTACTTCTTGCACGAC
CGGGCGGTGCGCGAATCGGGCCACGACACGACGTACCGCTTTGAGGGCATCTGCGCCGACTTGGCCACCATCGAT
CTCAACTCGCTGCTGTTCAAGTACGAGACGGACATTGCACGCACCATCCGCGCCGTCTTCAACGACCGTCTGGTG
ATGCCGGCCGAGTTTTGCGGCGGCACGCCCTACCGACCGGGCGACGTGCTCTCGTCAGCGGCCTGGGACCGGAGG
GCCAAGCGGCGCAAGCTCATGGTGGACCGGCTGATGTGGAACGAGTCCGAGGGCATGTTCTTCGACTACGACACT
GCCAAGCAGGAGCGGCGCACGTACGAGAGCTCGACGACGTTTTGGGCCATGTGGGCCGGCATCGCGACGCCCAAG
CAGGCGGCCGACATGGTCAAAAGGGCTCTACCGCGGTTCGAAGCCCACGGTGGTCTCTTGGCGGGCACGGAGAAG
TCGAGAGGCGAAGTCGGGCTGGAACGGCCGAACCGGCAGTGGGACTTTCCATACGGCTGGGCGCCGCAGCAGATG
CTTGCCTGGACGGGCTTGTTGCGCTATGGATTCAGCGAAGAGGCGGAGCGACTGGCCTACAAGTGGCTTCTGATG
ATTACCCGAGCCTTTGTCGACTTTAATGGCGTCGTGGTGGAAAAGTACGACGTGACGCGGTCGGCTGACCCGCAC
CGAGTCGACGCCGAGTACGGGAACCAGGGATTGGACTTTAAGGGCGTGGCCAAGGAGGGCTTCGGCTGGGTCAAC
TCGAGCTACGTGTACGGACTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTGACGCCGTATCCG
ACGTTTGTAAAGGCGGTGGAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGAGCCGGTGCCGAG
GCCTGA
Transcript >Ophun1|1334
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCCTCCGAGGAACGGCACTCCGGCATC
GGCTCCCGAACCCATTCCCACACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCTTTTCGCCGGAGCAGCCAT
GACGAGACGACGATGCTGCACGGCCGACGCTTCCTGATCCAGGTCGACGCCACTCTCGAGAGCCTTCGTGCCCAG
GAGGATACCGATGGCAACATGCAGATAACGGTCGAGGACAACGGCCCCAAGGTCCTGGCCCTTCGTACCGCCGGC
AACAACCGCTTCGACGTCCGCGGCACCTACATGCTGTCCAACCTGCTTCAGGAGTTGACGCTGGCCAAGGAGTAC
GGCCGCAAGCAGATCATCCTCGACGAGGGCCGCCTCAACGAGAACCCCGTCGACCGCCTGTCCCGCCTGATCCGC
GACCACTTCTGGGAGGGCCTCACCAGGCGCATCGACGCCTCCTCTATCGAGCTGGCGGCCCGCGACCCCAAGGAC
TGGACCGACGACCCTCGCCCCCGCATCTACGTCCCCGTCGGCGCTCCGGATCAGTACGAATATTACAAGCGCGTC
GCTGCCGATCGGCCAGATATCCGCCTCGACGTCCGCCTGCTGCCCGAACGCATCACGCCCGAGCTGATCCGTGAC
ATGAACGAGAAGCCGGGCCTGCTGGCTGTGGCCGTCGAGGAGGAAGAGGACTCTGACGGACGGATAACGCTCCGT
GGTCTGCCGTTTGTCGTCCCCGGTGGCCGCTTCAACGAGCTCTATGGCTGGGACAGCTATATGGAGTCGCTTGGC
CTCCTCATCGACGGGCGCGTCGACCTGGCCAAGTCAATGGTGCTCAACTTTTGCTTCTGCATACAGCACTACGGT
AAGATTCTCAACGCCACTAGATCTTACTACCTGGGCCGTTCTCAGCCGCCCTTCCTGACCGACATGGCCCTCCGC
GTCTACGAGCGCATCAAACACGAGCCCGGCGCACAAGAATTCCTCAAGCGCGCCATGTTAGCCGCCATCAAGGAG
TATCACAGCGTCTGGACGTGCGAGCCGCGTCTGGATCCCGTCACGGGCCTATCGCGGTACCGTCCCGAGGGCCTC
GGCGTGCCGCCCGAGACCGAAGCCGGCCATTTTGTGCACATCCTGGAGCCATACCTGGCCAAGTACGGAATGCCG
TTCGAGGAGCTGGTGCGTGCCTACAATCACGGCGACGTCAAGGAGCCTGCTCTTGATGAGTACTTCTTGCACGAC
CGGGCGGTGCGCGAATCGGGCCACGACACGACGTACCGCTTTGAGGGCATCTGCGCCGACTTGGCCACCATCGAT
CTCAACTCGCTGCTGTTCAAGTACGAGACGGACATTGCACGCACCATCCGCGCCGTCTTCAACGACCGTCTGGTG
ATGCCGGCCGAGTTTTGCGGCGGCACGCCCTACCGACCGGGCGACGTGCTCTCGTCAGCGGCCTGGGACCGGAGG
GCCAAGCGGCGCAAGCTCATGGTGGACCGGCTGATGTGGAACGAGTCCGAGGGCATGTTCTTCGACTACGACACT
GCCAAGCAGGAGCGGCGCACGTACGAGAGCTCGACGACGTTTTGGGCCATGTGGGCCGGCATCGCGACGCCCAAG
CAGGCGGCCGACATGGTCAAAAGGGCTCTACCGCGGTTCGAAGCCCACGGTGGTCTCTTGGCGGGCACGGAGAAG
TCGAGAGGCGAAGTCGGGCTGGAACGGCCGAACCGGCAGTGGGACTTTCCATACGGCTGGGCGCCGCAGCAGATG
CTTGCCTGGACGGGCTTGTTGCGCTATGGATTCAGCGAAGAGGCGGAGCGACTGGCCTACAAGTGGCTTCTGATG
ATTACCCGAGCCTTTGTCGACTTTAATGGCGTCGTGGTGGAAAAGTACGACGTGACGCGGTCGGCTGACCCGCAC
CGAGTCGACGCCGAGTACGGGAACCAGGGATTGGACTTTAAGGGCGTGGCCAAGGAGGGCTTCGGCTGGGTCAAC
TCGAGCTACGTGTACGGACTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTGACGCCGTATCCG
ACGTTTGTAAAGGCGGTGGAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGAGCCGGTGCCGAG
GCCTGA
Gene >Ophun1|1334
ATGGCACATGACGGCTGTGGCATCTACGATGACGCAAAGACGTATTACGCCTCCGAGGAACGGCACTCCGGCATC
GGCTCCCGAACCCATTCCCACGTCCGTCTCTCCCGTCCGGTCCGAGGCTCTTGGCCGAGACTGACGGCCAGAAAC
AGACCAGCCTGCATCGGCACCCGGAGGCTCACGAGCCTTTTCGCCGGAGCAGCCATGGTTTGTCTCGTCTCTGCT
CGCTCCGACTGACGGACGCTGACGGACGGCAGACGAGACGACGATGCTGCACGGCCGACGCTTCCTGATCCAGGT
CGACGCCACTCTCGAGAGCCTTCGTGCCCAGGAGGATACCGATGGCAACATGCAGATAACGGTCGAGGACAACGG
CCCCAAGGTCCTGGCCCTTCGTACCGCCGGCAACAACCGCTTCGACGTCCGCGGCACCTACATGCTGTCCAACCT
GCTTCAGGAGTTGACGCTGGCCAAGGAGTACGGCCGCAAGCAGATCATCCTCGACGAGGGCCGCCTCAACGAGAA
CCCCGTCGACCGCCTGTCCCGCCTGATCCGCGACCACTTCTGGGAGGGCCTCACCAGGCGCATCGACGCCTCCTC
TATCGAGCTGGCGGCCCGCGACCCCAAGGACTGGACCGACGACCCTCGCCCCCGCATCTACGTCCCCGTCGGCGC
TCCGGATCAGTACGAATATTACAAGCGCGTCGCTGCCGATCGGCCAGATATCCGCCTCGACGTCCGCCTGCTGCC
CGAACGCATCACGCCCGAGCTGATCCGTGACATGAACGAGAAGCCGGGCCTGCTGGCTGTGGCCGTCGAGGAGGA
AGAGGACTCTGACGGACGGATAACGCTCCGTGGTCTGCCGTTTGTCGTCCCCGGTGGCCGCTTCAACGAGCTCTA
TGGCTGGGACAGCTATATGGAGTCGCTTGGCCTCCTCATCGACGGGCGCGTCGACCTGGCCAAGTCAATGGTGCT
CAACTTTTGCTTCTGCATACAGCACTACGGTAAGATTCTCAACGCCACTAGATCTTACTACCTGGGCCGTTCTCA
GCCGCCCTTCCTGACCGACATGGCCCTCCGCGTCTACGAGCGCATCAAACACGAGCCCGGCGCACAAGAATTCCT
CAAGCGCGCCATGTTAGCCGCCATCAAGGAGTATCACAGCGTCTGGACGTGCGAGCCGCGTCTGGATCCCGTCAC
GGGCCTATCGCGGTACCGTCCCGAGGGCCTCGGCGTGCCGCCCGAGACCGAAGCCGGCCATTTTGTGCACATCCT
GGAGCCATACCTGGCCAAGTACGGAATGCCGTTCGAGGAGCTGGTGCGTGCCTACAATCACGGCGACGTCAAGGA
GCCTGCTCTTGATGAGTACTTCTTGCACGACCGGGCGGTGCGCGAATCGGGCCACGACACGACGTACCGCTTTGA
GGGCATCTGCGCCGACTTGGCCACCATCGATCTCAACTCGCTGCTGTTCAAGTACGAGACGGACATTGCACGCAC
CATCCGCGCCGTCTTCAACGACCGTCTGGTGATGCCGGCCGAGTTTTGCGGCGGCACGCCCTACCGACCGGGCGA
CGTGCTCTCGTCAGCGGCCTGGGACCGGAGGGCCAAGCGGCGCAAGCTCATGGTGGACCGGCTGATGTGGAACGA
GTCCGAGGGCATGTTCTTCGACTACGACACTGCCAAGCAGGAGCGGCGCACGTACGAGAGCTCGACGACGTTTTG
GGCCATGTGGGCCGGCATCGCGACGCCCAAGCAGGCGGCCGACATGGTCAAAAGGGCTCTACCGCGGTTCGAAGC
CCACGGTGGTCTCTTGGCGGGCACGGAGAAGTCGAGAGGCGAAGTCGGGCTGGAACGGCCGAACCGGCAGTGGGA
CTTTCCATACGGCTGGGCGCCGCAGCAGATGCTTGCCTGGACGGGCTTGTTGCGCTATGGATTCAGCGAAGAGGC
GGAGCGACTGGCCTACAAGTGGCTTCTGATGATTACCCGAGCCTTTGTCGACTTTAATGGCGTCGTGGTGGAAAA
GTACGACGTGACGCGGTCGGCTGACCCGCACCGAGTCGACGCCGAGTACGGGAACCAGGGATTGGACTTTAAGGG
CGTGGCCAAGGAGGGGTGAGCGAGCCCTTTTATCAACTGTTTGTTGTGGTTGATTTACTGACGGGACGCAGCTTC
GGCTGGGTCAACTCGAGCTACGTGTACGGACTGGAGATTATCAACGCACACATGCGGCGCGCCCTGGGCACGTTG
ACGCCGTATCCGACGTTTGTAAAGGCGGTGGAACAGACCAACGAACGGGCGCTGGCCGAGCTGTCGCTGACGGGA
GCCGGTGCCGAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail