Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1331
Gene name
LocationContig_152:25145..25485
Strand-
Gene length (bp)340
Transcript length (bp)243
Coding sequence length (bp)243
Protein length (aa) 81

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999773

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4687
Ophiocordyceps australis map64 (Brazil) OphauB2|3198
Ophiocordyceps camponoti-floridani Ophcf2|00974
Ophiocordyceps camponoti-rufipedis Ophun1|1331 (this protein)
Ophiocordyceps kimflemingae Ophio5|2017
Ophiocordyceps subramaniannii Hirsu2|5965

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1331
MKFLAITIAALASVVAAGEYGKECEPATYSCTYQYGKPGWQVCNTSGKWEFGGFCPPKTHCEFNKENGSPYCIPS
GWKKE*
Coding >Ophun1|1331
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTCGCCTCCGTCGTCGCCGCCGGCGAGTACGGAAAGGAGTGCGAG
CCCGCCACCTACTCCTGCACCTACCAGTACGGCAAGCCCGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
TTCGGCGGCTTCTGCCCGCCCAAGACGCACTGCGAGTTCAACAAGGAGAACGGCAGCCCCTACTGCATCCCCAGC
GGCTGGAAGAAGGAGTAA
Transcript >Ophun1|1331
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTCGCCTCCGTCGTCGCCGCCGGCGAGTACGGAAAGGAGTGCGAG
CCCGCCACCTACTCCTGCACCTACCAGTACGGCAAGCCCGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
TTCGGCGGCTTCTGCCCGCCCAAGACGCACTGCGAGTTCAACAAGGAGAACGGCAGCCCCTACTGCATCCCCAGC
GGCTGGAAGAAGGAGTAA
Gene >Ophun1|1331
ATGAAGTTCCTCGCCATCACCATCGCCGCCCTCGCCTCCGTCGTCGCCGCCGGCGAGTACGGAAAGGAGTGCGAG
CCCGCCACCTACTCCTGCACCTACCAGTACGGCAAGCCCGGCTGGCAGGTCTGCAACACGAGCGGAAAGTGGGAG
GTGAGTCTTTTTCTCTTCTCTTCTCTTATTCTTCTTCTTCTCTCTTCTCTCGTTTCGCATCTACATGACCCGTGT
CTGACTCACCTACCCCCATCAGTTCGGCGGCTTCTGCCCGCCCAAGACGCACTGCGAGTTCAACAAGGAGAACGG
CAGCCCCTACTGCATCCCCAGCGGCTGGAAGAAGGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail