Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1327
Gene name
LocationContig_152:16857..17757
Strand-
Gene length (bp)900
Transcript length (bp)726
Coding sequence length (bp)726
Protein length (aa) 242

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02230 Abhydrolase_2 Phospholipase/Carboxylesterase 1.4E-50 13 233
PF03959 FSH1 Serine hydrolase (FSH1) 5.3E-06 21 190

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFJ5|APTH1_NEUCR Acyl-protein thioesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B2J23.070 PE=3 SV=2 5 240 2.0E-73
sp|Q4I8Q4|APTH1_GIBZE Acyl-protein thioesterase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_06404 PE=3 SV=1 8 239 1.0E-65
sp|Q5ASI2|APTH1_EMENI Acyl-protein thioesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8748 PE=3 SV=1 10 239 7.0E-62
sp|Q4WCX7|APTH1_ASPFU Acyl-protein thioesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G02780 PE=3 SV=1 10 239 4.0E-60
sp|Q6CGL4|APTH1_YARLI Acyl-protein thioesterase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A18337g PE=3 SV=1 14 236 4.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HFJ5|APTH1_NEUCR Acyl-protein thioesterase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B2J23.070 PE=3 SV=2 5 240 2.0E-73
sp|Q4I8Q4|APTH1_GIBZE Acyl-protein thioesterase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=FGSG_06404 PE=3 SV=1 8 239 1.0E-65
sp|Q5ASI2|APTH1_EMENI Acyl-protein thioesterase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN8748 PE=3 SV=1 10 239 7.0E-62
sp|Q4WCX7|APTH1_ASPFU Acyl-protein thioesterase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_6G02780 PE=3 SV=1 10 239 4.0E-60
sp|Q6CGL4|APTH1_YARLI Acyl-protein thioesterase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0A18337g PE=3 SV=1 14 236 4.0E-53
sp|Q5RBR7|LYPA1_PONAB Acyl-protein thioesterase 1 OS=Pongo abelii GN=LYPLA1 PE=2 SV=1 1 238 5.0E-49
sp|O75608|LYPA1_HUMAN Acyl-protein thioesterase 1 OS=Homo sapiens GN=LYPLA1 PE=1 SV=1 1 238 9.0E-49
sp|P70470|LYPA1_RAT Acyl-protein thioesterase 1 OS=Rattus norvegicus GN=Lypla1 PE=1 SV=1 1 238 3.0E-47
sp|O77821|LYPA1_RABIT Acyl-protein thioesterase 1 OS=Oryctolagus cuniculus GN=LYPLA1 PE=1 SV=1 1 238 5.0E-47
sp|P97823|LYPA1_MOUSE Acyl-protein thioesterase 1 OS=Mus musculus GN=Lypla1 PE=1 SV=1 1 238 5.0E-47
sp|Q3MHR0|LYPA1_BOVIN Acyl-protein thioesterase 1 OS=Bos taurus GN=LYPLA1 PE=2 SV=1 1 238 6.0E-47
sp|Q6BSS8|APTH1_DEBHA Acyl-protein thioesterase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DEHA2D06534g PE=3 SV=2 22 236 2.0E-46
sp|Q4PID3|APTH1_USTMA Acyl-protein thioesterase 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_00130 PE=3 SV=1 19 239 4.0E-46
sp|Q6CJK6|APTH1_KLULA Acyl-protein thioesterase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KLLA0F17908g PE=3 SV=1 23 236 2.0E-45
sp|Q54T49|APT11_DICDI Acyl-protein thioesterase 1 homolog 1 OS=Dictyostelium discoideum GN=DDB_G0282005 PE=2 SV=1 17 237 4.0E-44
sp|Q9WTL7|LYPA2_MOUSE Acyl-protein thioesterase 2 OS=Mus musculus GN=Lypla2 PE=1 SV=1 19 238 1.0E-43
sp|Q9QYL8|LYPA2_RAT Acyl-protein thioesterase 2 OS=Rattus norvegicus GN=Lypla2 PE=1 SV=1 19 238 1.0E-43
sp|O95372|LYPA2_HUMAN Acyl-protein thioesterase 2 OS=Homo sapiens GN=LYPLA2 PE=1 SV=1 19 238 4.0E-43
sp|Q5AGD1|APTH1_CANAL Acyl-protein thioesterase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CaO19.11723 PE=3 SV=2 15 232 8.0E-43
sp|Q12354|APTH1_YEAST Acyl-protein thioesterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR118C PE=1 SV=1 8 236 1.0E-41
sp|P0CL94|APTH1_CRYNJ Acyl-protein thioesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CNF02430 PE=3 SV=1 20 236 5.0E-41
sp|P0CL95|APTH1_CRYNB Acyl-protein thioesterase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CNBF2260 PE=3 SV=1 20 236 5.0E-41
sp|Q6FW75|APTH1_CANGA Acyl-protein thioesterase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CAGL0D02398g PE=3 SV=1 24 236 1.0E-36
sp|O42881|APTH1_SCHPO Acyl-protein thioesterase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC8E11.04c PE=3 SV=1 12 231 2.0E-34
sp|Q750X7|APTH1_ASHGO Acyl-protein thioesterase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=AGL188W PE=3 SV=1 1 236 3.0E-31
sp|Q55FK4|APT12_DICDI Acyl-protein thioesterase 1 homolog 2 OS=Dictyostelium discoideum GN=DDB_G0268064 PE=1 SV=1 20 237 1.0E-28
sp|Q0J969|CAEH1_ORYSJ Probable carboxylesterase Os04g0669500 OS=Oryza sativa subsp. japonica GN=Os04g0669500 PE=3 SV=1 19 236 4.0E-28
sp|Q8GYK2|SOBRL_ARATH Probable carboxylesterase SOBER1-like OS=Arabidopsis thaliana GN=At4g22300 PE=2 SV=1 24 236 9.0E-27
sp|Q5VWZ2|LYPL1_HUMAN Lysophospholipase-like protein 1 OS=Homo sapiens GN=LYPLAL1 PE=1 SV=3 2 237 2.0E-24
sp|Q84WK4|SOBR1_ARATH Carboxylesterase SOBER1 OS=Arabidopsis thaliana GN=SOBER1 PE=1 SV=1 24 236 3.0E-24
sp|Q51758|EST1_PSEFL Carboxylesterase 1 OS=Pseudomonas fluorescens GN=estA PE=3 SV=1 11 236 3.0E-23
sp|Q5R8C2|LYPL1_PONAB Lysophospholipase-like protein 1 OS=Pongo abelii GN=LYPLAL1 PE=2 SV=3 2 237 4.0E-23
sp|Q3UFF7|LYPL1_MOUSE Lysophospholipase-like protein 1 OS=Mus musculus GN=Lyplal1 PE=1 SV=3 13 237 5.0E-23
sp|Q53547|EST2_PSEFL Carboxylesterase 2 OS=Pseudomonas fluorescens GN=estB PE=1 SV=1 11 236 3.0E-22
sp|Q7XR62|CAEH3_ORYSJ Probable inactive carboxylesterase Os04g0669700 OS=Oryza sativa subsp. japonica GN=Os04g0669700 PE=3 SV=1 15 225 2.0E-20
sp|Q0J968|CAEH2_ORYSJ Probable carboxylesterase Os04g0669600 OS=Oryza sativa subsp. japonica GN=Os04g0669600 PE=2 SV=1 24 236 8.0E-17
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1327
MSSTALQRAAPMVFPAVGRHTATVLFAHGLGDTAAGWAHAVQFWRRDRRLDEVKFVLPNAPVRPITLNGGLRMPG
WFDMHGLLPSPQCKASDASKDHDGILESRDYIETIIKDEVSAGIPGDRIVIGGFSQGALISVFATLASPVKLAGA
VCLSSFFSNEFNHWGLVADNGVNKTTPVFMGHGDEDDIICLDFGKRTESLLKEHGFSVTFKTYKGVAHSASLEEL
QDVAAFLAERLPPQAS*
Coding >Ophun1|1327
ATGTCTTCGACGGCTCTTCAGCGCGCTGCGCCCATGGTCTTCCCGGCTGTGGGCAGACACACGGCCACCGTCTTG
TTCGCTCACGGCCTGGGAGATACGGCGGCCGGCTGGGCGCACGCTGTCCAGTTCTGGCGTCGAGACCGGAGGCTG
GACGAGGTCAAGTTTGTGCTTCCCAATGCGCCGGTGCGGCCCATTACCTTGAATGGAGGCCTACGGATGCCGGGC
TGGTTCGACATGCATGGTCTGCTTCCCTCGCCCCAATGCAAGGCGTCAGACGCCTCCAAAGATCACGACGGCATC
CTCGAGTCCCGCGACTACATCGAGACGATTATCAAGGACGAGGTTTCGGCCGGCATCCCAGGCGACCGTATCGTC
ATCGGCGGCTTCTCCCAGGGGGCACTCATCAGCGTGTTTGCGACGCTCGCTTCGCCCGTCAAGCTGGCGGGTGCC
GTGTGTCTCTCTTCTTTCTTCTCCAACGAATTTAACCATTGGGGGCTGGTCGCGGATAACGGCGTGAATAAGACG
ACGCCTGTCTTTATGGGACATGGTGACGAGGACGATATTATCTGCCTTGACTTTGGGAAGAGGACCGAGTCGTTG
CTCAAGGAGCATGGCTTCTCTGTTACGTTCAAGACGTACAAGGGTGTCGCTCACTCGGCGAGTCTGGAGGAACTT
CAAGACGTGGCCGCCTTCCTAGCGGAGAGATTGCCGCCGCAGGCTTCATGA
Transcript >Ophun1|1327
ATGTCTTCGACGGCTCTTCAGCGCGCTGCGCCCATGGTCTTCCCGGCTGTGGGCAGACACACGGCCACCGTCTTG
TTCGCTCACGGCCTGGGAGATACGGCGGCCGGCTGGGCGCACGCTGTCCAGTTCTGGCGTCGAGACCGGAGGCTG
GACGAGGTCAAGTTTGTGCTTCCCAATGCGCCGGTGCGGCCCATTACCTTGAATGGAGGCCTACGGATGCCGGGC
TGGTTCGACATGCATGGTCTGCTTCCCTCGCCCCAATGCAAGGCGTCAGACGCCTCCAAAGATCACGACGGCATC
CTCGAGTCCCGCGACTACATCGAGACGATTATCAAGGACGAGGTTTCGGCCGGCATCCCAGGCGACCGTATCGTC
ATCGGCGGCTTCTCCCAGGGGGCACTCATCAGCGTGTTTGCGACGCTCGCTTCGCCCGTCAAGCTGGCGGGTGCC
GTGTGTCTCTCTTCTTTCTTCTCCAACGAATTTAACCATTGGGGGCTGGTCGCGGATAACGGCGTGAATAAGACG
ACGCCTGTCTTTATGGGACATGGTGACGAGGACGATATTATCTGCCTTGACTTTGGGAAGAGGACCGAGTCGTTG
CTCAAGGAGCATGGCTTCTCTGTTACGTTCAAGACGTACAAGGGTGTCGCTCACTCGGCGAGTCTGGAGGAACTT
CAAGACGTGGCCGCCTTCCTAGCGGAGAGATTGCCGCCGCAGGCTTCATGA
Gene >Ophun1|1327
ATGTCTTCGACGGCTCTTCAGCGCGCTGCGCCCATGGTCTTCCCGGCTGTGGGCAGACACACGGCCACCGTCTTG
TTCGCTCACGGCCTGGGAGATACGGCGGCCGGCTGGGCGCACGCTGTCCAGTTCTGGCGTCGAGACCGGAGGCTG
GACGAGGTCAAGTTTGTGCTTCCCAATGCGCCGGTGCGGCCCATTACCTTGGTGAGGATCAATCTCTGCACCTGG
CGCGAGGGGATTCGCTGACGTATCGGGTAGAATGGAGGCCTACGGATGCCGGGCTGGTTCGACATGGTGAGCTCG
GCTTCCAACGCAAAGAACAGCTTTGGCTGATTTGGCTCAACGCAGCATGGTCTGCTTCCCTCGCCCCAATGCAAG
GCGTCAGACGCCTCCAAAGATCACGACGGCATCCTCGAGTCCCGCGACTACATCGAGACGATTATCAAGGACGAG
GTTTCGGCCGGCATCCCAGGCGACCGTATCGTCATCGGCGGCTTCTCCCAGGGGGCACTCATCAGCGTGTTTGCG
ACGCTCGCTTCGCCCGTCAAGCTGGCGGGTGCCGTGTGTCTCTCTTCTTTCTTCTCCAACGAATTTAACCATTGG
GGGCTGGTCGCGGATAACGGCGTGAATAAGACGACGCCTGTCTTTATGGGACATGGTGACGAGGACGATATTATC
TGCCTTGACTTTGGGAAGAGGACCGAGTCGTTGCTCAAGGAGCATGGCTTCTCTGTTACGTTCAAGACGTACAAG
TCAGTTTCCCCGAACTCTTGCGTGGTCTCTAGTCTTGCACAATTGCTGATGCTGATATCAACCAGGGGTGTCGCT
CACTCGGCGAGTCTGGAGGAACTTCAAGACGTGGCCGCCTTCCTAGCGGAGAGATTGCCGCCGCAGGCTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail