Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1325
Gene name
LocationContig_152:15244..15616
Strand-
Gene length (bp)372
Transcript length (bp)372
Coding sequence length (bp)372
Protein length (aa) 124

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00576 Transthyretin HIUase/Transthyretin family 9.3E-33 7 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74492|HIUH_SCHPO Probable 5-hydroxyisourate hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC285.04 PE=3 SV=1 6 123 4.0E-16
sp|Q8ZQ52|HIUH_SALTY 5-hydroxyisourate hydrolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hiuH PE=3 SV=1 5 123 6.0E-15
sp|Q4VYA5|HIUH_SALDU 5-hydroxyisourate hydrolase OS=Salmonella dublin GN=hiuH PE=1 SV=1 5 123 7.0E-15
sp|Q8Z7Q6|HIUH_SALTI 5-hydroxyisourate hydrolase OS=Salmonella typhi GN=hiuH PE=3 SV=1 5 123 7.0E-15
sp|Q9CRB3|HIUH_MOUSE 5-hydroxyisourate hydrolase OS=Mus musculus GN=Urah PE=1 SV=1 1 123 8.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74492|HIUH_SCHPO Probable 5-hydroxyisourate hydrolase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC285.04 PE=3 SV=1 6 123 4.0E-16
sp|Q8ZQ52|HIUH_SALTY 5-hydroxyisourate hydrolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=hiuH PE=3 SV=1 5 123 6.0E-15
sp|Q4VYA5|HIUH_SALDU 5-hydroxyisourate hydrolase OS=Salmonella dublin GN=hiuH PE=1 SV=1 5 123 7.0E-15
sp|Q8Z7Q6|HIUH_SALTI 5-hydroxyisourate hydrolase OS=Salmonella typhi GN=hiuH PE=3 SV=1 5 123 7.0E-15
sp|Q9CRB3|HIUH_MOUSE 5-hydroxyisourate hydrolase OS=Mus musculus GN=Urah PE=1 SV=1 1 123 8.0E-15
sp|P76341|HIUH_ECOLI 5-hydroxyisourate hydrolase OS=Escherichia coli (strain K12) GN=hiuH PE=1 SV=1 2 123 1.0E-13
sp|Q8XB75|HIUH_ECO57 5-hydroxyisourate hydrolase OS=Escherichia coli O157:H7 GN=hiuH PE=3 SV=1 2 123 1.0E-13
sp|Q92VB9|HIUH1_RHIME 5-hydroxyisourate hydrolase 1 OS=Rhizobium meliloti (strain 1021) GN=RB0789 PE=3 SV=1 7 123 4.0E-13
sp|Q9LVM5|TTHL_ARATH Uric acid degradation bifunctional protein TTL OS=Arabidopsis thaliana GN=TTL PE=1 SV=1 7 123 1.0E-12
sp|O32142|HIUH_BACSU 5-hydroxyisourate hydrolase OS=Bacillus subtilis (strain 168) GN=pucM PE=1 SV=2 7 123 7.0E-12
sp|O44578|HIUH2_CAEEL Probable 5-hydroxyisourate hydrolase ZK697.8 OS=Caenorhabditis elegans GN=ZK697.8 PE=3 SV=2 6 123 8.0E-12
sp|Q21882|HIUH1_CAEEL Probable 5-hydroxyisourate hydrolase R09H10.3 OS=Caenorhabditis elegans GN=R09H10.3 PE=1 SV=2 6 123 1.0E-11
sp|Q9KET9|HIUH_BACHD 5-hydroxyisourate hydrolase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=BH0760 PE=3 SV=1 7 123 9.0E-11
sp|Q9I3J5|HIUH_PSEAE 5-hydroxyisourate hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1518 PE=3 SV=1 7 123 8.0E-10
sp|Q92UG5|HIUH2_RHIME 5-hydroxyisourate hydrolase 2 OS=Rhizobium meliloti (strain 1021) GN=RB1166 PE=3 SV=2 1 123 1.0E-09
sp|Q06S87|HIUH_DANRE 5-hydroxyisourate hydrolase OS=Danio rerio GN=urah PE=1 SV=1 7 123 2.0E-09
sp|Q9A545|HIUH_CAUCR 5-hydroxyisourate hydrolase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=CC_2620 PE=3 SV=1 7 123 2.0E-09
sp|Q98CI7|HIUH_RHILO 5-hydroxyisourate hydrolase OS=Rhizobium loti (strain MAFF303099) GN=mlr5133 PE=3 SV=1 7 123 4.0E-09
sp|Q9RV69|HIUH_DEIRA 5-hydroxyisourate hydrolase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_1161 PE=3 SV=1 1 123 1.0E-08
sp|Q8XXJ7|HIUH_RALSO 5-hydroxyisourate hydrolase OS=Ralstonia solanacearum (strain GMI1000) GN=RSc2116 PE=3 SV=1 7 123 1.0E-08
sp|Q8YFU1|HIUH_BRUME 5-hydroxyisourate hydrolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=BMEI1429 PE=3 SV=2 7 123 2.0E-06
sp|Q8G228|HIUH_BRUSU 5-hydroxyisourate hydrolase OS=Brucella suis biovar 1 (strain 1330) GN=BR0508 PE=3 SV=1 7 123 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5386
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7339
Ophiocordyceps australis map64 (Brazil) OphauB2|5398
Ophiocordyceps camponoti-floridani Ophcf2|00980
Ophiocordyceps camponoti-rufipedis Ophun1|1325 (this protein)
Ophiocordyceps kimflemingae Ophio5|4763
Ophiocordyceps subramaniannii Hirsu2|5477

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1325
MAAKDAITCHVLDTAAGHPAKGIRVRLEHAAVAFESLTDDDGRIAAWLPYSSAGEVPVYTLDDVLGSVEGPSNWT
LRFDTEGYFGTGNTFFPEAVVVFRVVPGQRYHVPLLLSPFGYTTYRGS*
Coding >Ophun1|1325
ATGGCCGCCAAAGACGCCATCACCTGCCACGTCCTCGACACCGCAGCCGGTCACCCGGCAAAGGGCATCCGCGTC
CGGCTCGAGCACGCAGCCGTGGCGTTCGAGTCCCTTACAGACGACGACGGCCGCATCGCCGCCTGGCTGCCCTAC
AGCTCCGCCGGCGAGGTCCCCGTTTATACGCTCGACGACGTCCTCGGCTCCGTCGAGGGCCCTTCCAACTGGACT
CTGCGCTTCGACACCGAGGGCTACTTTGGCACCGGCAATACCTTCTTCCCAGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATACCACGTTCCTTTGCTGCTGAGCCCTTTCGGCTACACCACCTACCGGGGAAGCTGA
Transcript >Ophun1|1325
ATGGCCGCCAAAGACGCCATCACCTGCCACGTCCTCGACACCGCAGCCGGTCACCCGGCAAAGGGCATCCGCGTC
CGGCTCGAGCACGCAGCCGTGGCGTTCGAGTCCCTTACAGACGACGACGGCCGCATCGCCGCCTGGCTGCCCTAC
AGCTCCGCCGGCGAGGTCCCCGTTTATACGCTCGACGACGTCCTCGGCTCCGTCGAGGGCCCTTCCAACTGGACT
CTGCGCTTCGACACCGAGGGCTACTTTGGCACCGGCAATACCTTCTTCCCAGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATACCACGTTCCTTTGCTGCTGAGCCCTTTCGGCTACACCACCTACCGGGGAAGCTGA
Gene >Ophun1|1325
ATGGCCGCCAAAGACGCCATCACCTGCCACGTCCTCGACACCGCAGCCGGTCACCCGGCAAAGGGCATCCGCGTC
CGGCTCGAGCACGCAGCCGTGGCGTTCGAGTCCCTTACAGACGACGACGGCCGCATCGCCGCCTGGCTGCCCTAC
AGCTCCGCCGGCGAGGTCCCCGTTTATACGCTCGACGACGTCCTCGGCTCCGTCGAGGGCCCTTCCAACTGGACT
CTGCGCTTCGACACCGAGGGCTACTTTGGCACCGGCAATACCTTCTTCCCAGAGGCTGTCGTCGTCTTCCGCGTC
GTGCCTGGCCAGCGATACCACGTTCCTTTGCTGCTGAGCCCTTTCGGCTACACCACCTACCGGGGAAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail