Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1323
Gene name
LocationContig_152:11885..13396
Strand-
Gene length (bp)1511
Transcript length (bp)1275
Coding sequence length (bp)1275
Protein length (aa) 425

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03381 CDC50 LEM3 (ligand-effect modulator 3) family / CDC50 family 2.7E-97 72 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 398 4.0E-135
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 397 3.0E-114
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 22 399 6.0E-109
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 27 402 2.0E-101
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 3 398 1.0E-90
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTQ5|MUG89_SCHPO Meiotically up-regulated gene 89 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug89 PE=1 SV=1 28 398 4.0E-135
sp|P25656|CDC50_YEAST Cell division control protein 50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC50 PE=1 SV=1 21 397 3.0E-114
sp|Q96WW4|IVN1_SCHPO Invasion protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ivn1 PE=3 SV=1 22 399 6.0E-109
sp|P53740|YN8S_YEAST Uncharacterized protein YNR048W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YNR048W PE=1 SV=1 27 402 2.0E-101
sp|P42838|LEM3_YEAST Alkylphosphocholine resistance protein LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEM3 PE=1 SV=1 3 398 1.0E-90
sp|Q9LTW0|ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana GN=ALIS1 PE=1 SV=1 26 401 3.0E-66
sp|Q8L8W0|ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana GN=ALIS5 PE=1 SV=1 26 409 1.0E-64
sp|Q9SLK2|ALIS3_ARATH ALA-interacting subunit 3 OS=Arabidopsis thaliana GN=ALIS3 PE=1 SV=1 26 401 3.0E-63
sp|Q9SA35|ALIS4_ARATH Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana GN=ALIS4 PE=2 SV=2 33 409 2.0E-57
sp|Q3MIR4|CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens GN=TMEM30B PE=1 SV=1 27 383 2.0E-57
sp|H2L0H3|CHAT1_CAEEL CDC50 family protein chat-1 OS=Caenorhabditis elegans GN=chat-1 PE=2 SV=1 3 383 9.0E-56
sp|Q8BHG3|CC50B_MOUSE Cell cycle control protein 50B OS=Mus musculus GN=Tmem30b PE=2 SV=1 27 383 3.0E-55
sp|Q5F362|CC50A_CHICK Cell cycle control protein 50A OS=Gallus gallus GN=TMEM30A PE=2 SV=1 28 382 4.0E-55
sp|Q8VEK0|CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus GN=Tmem30a PE=1 SV=1 28 382 2.0E-51
sp|Q17QL5|CC50A_BOVIN Cell cycle control protein 50A OS=Bos taurus GN=TMEM30A PE=1 SV=1 28 382 4.0E-50
sp|Q5R6C0|CC50A_PONAB Cell cycle control protein 50A OS=Pongo abelii GN=TMEM30A PE=2 SV=1 28 382 9.0E-50
sp|Q9NV96|CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens GN=TMEM30A PE=1 SV=1 28 382 1.0E-49
sp|Q67YS6|ALIS2_ARATH Putative ALA-interacting subunit 2 OS=Arabidopsis thaliana GN=ALIS2 PE=2 SV=1 16 399 3.0E-45
sp|Q2T9P5|CC50C_BOVIN Cell cycle control protein 50C OS=Bos taurus GN=TMEM30C PE=2 SV=1 28 388 7.0E-40
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 157 382 1.0E-36
sp|Q95JK4|CC50C_MACFA Cell cycle control protein 50C OS=Macaca fascicularis GN=TMEM30C PE=2 SV=1 18 388 1.0E-36
sp|Q9D4D7|CC50C_MOUSE Cell cycle control protein 50C OS=Mus musculus GN=Tmem30c PE=2 SV=2 24 387 9.0E-35
sp|Q6AY41|CC50A_RAT Cell cycle control protein 50A OS=Rattus norvegicus GN=Tmem30a PE=2 SV=1 28 56 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 53 75 22
2 359 381 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3556
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7337
Ophiocordyceps australis map64 (Brazil) OphauB2|5396
Ophiocordyceps camponoti-floridani Ophcf2|00983
Ophiocordyceps camponoti-rufipedis Ophun1|1323 (this protein)
Ophiocordyceps kimflemingae Ophio5|4765
Ophiocordyceps subramaniannii Hirsu2|6826

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1323
MSDSPPGAGQADSINSHESSPKHPEKKKSRRPANTAFRQQRLKAWQPILTPKTVLPLFFTIGIIFAPIGGLLLYA
SAKVQEIIIDYSKCLEQARPGVFTEIPSNRVYAAFKSSNRTIDAKWSTNNNVDVLVERTGVEIMTNQCILEFEIP
DSMNPPVLFYYKLTNFHQNHRRYVESFDQDQLKGEAVPFDKIKTSKCNPLYGEGDKPYYPCGLIANSLFNDTFSS
PVLLNPPGAIGNETRTYDMTQQGIAWSSDKALYGKTTYNFTDILPPPNWKVRYPDGYTEKNPPPDLKTDEVFQNW
MRTAALPSFSKLYQRNDTASMDKGRYRVTINDYFPTSEYKGTKSIVITTRTVMGGRNPFLGIAYLVVGGLCILLG
TIFTVTHLIKPRKLGDHTYLSWNKVPTAPRSAGASAAIASGREIRPSEA*
Coding >Ophun1|1323
ATGTCCGACTCGCCTCCGGGCGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACCCGGAG
AAGAAGAAGAGCCGGCGGCCTGCGAATACTGCTTTCCGTCAGCAGCGTCTCAAGGCTTGGCAACCCATCTTGACG
CCCAAGACGGTGCTGCCTTTGTTCTTCACCATCGGCATCATATTCGCTCCCATCGGGGGCCTTCTCCTCTACGCC
AGCGCAAAGGTCCAGGAGATCATCATCGATTACTCAAAGTGCTTAGAACAGGCGCGGCCAGGCGTCTTCACCGAG
ATCCCCAGCAATAGGGTATACGCCGCCTTCAAGAGCAGCAACAGAACCATCGACGCAAAATGGTCAACGAACAAT
AACGTCGATGTCCTTGTGGAAAGGACGGGCGTCGAAATCATGACCAATCAATGCATCCTCGAATTCGAAATTCCC
GACAGCATGAACCCGCCCGTTCTGTTCTACTACAAGCTCACAAACTTCCATCAGAACCACCGTCGCTACGTCGAG
TCGTTCGATCAGGACCAGCTCAAAGGAGAGGCTGTCCCATTTGACAAGATCAAGACGTCCAAGTGCAATCCGCTC
TACGGCGAAGGCGATAAACCATACTACCCCTGCGGACTCATCGCCAACTCTCTCTTCAACGATACCTTTAGCTCG
CCCGTCTTGCTCAACCCCCCCGGAGCTATAGGCAACGAGACTCGCACCTATGACATGACACAACAGGGCATCGCC
TGGAGCAGCGACAAGGCTCTCTACGGCAAGACGACGTACAACTTCACCGACATCCTCCCTCCTCCGAACTGGAAG
GTTCGATATCCCGACGGCTACACGGAGAAGAATCCTCCTCCCGATCTCAAGACGGACGAGGTCTTCCAGAACTGG
ATGCGAACAGCTGCTCTGCCGTCCTTTAGCAAACTGTACCAGAGGAACGACACCGCAAGTATGGACAAAGGCCGA
TACCGCGTCACCATCAACGACTACTTCCCAACGTCGGAATACAAGGGCACCAAGTCCATCGTCATCACAACCCGC
ACCGTCATGGGAGGGCGCAACCCGTTCCTGGGCATCGCCTACCTCGTAGTCGGAGGCCTCTGCATCCTCCTCGGC
ACCATCTTCACCGTCACCCATCTCATCAAGCCCAGAAAACTGGGCGATCACACGTACCTCTCCTGGAACAAGGTT
CCCACCGCTCCCAGATCGGCTGGCGCTTCGGCTGCCATAGCTTCGGGCCGTGAGATTCGCCCCAGTGAAGCCTAG
Transcript >Ophun1|1323
ATGTCCGACTCGCCTCCGGGCGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACCCGGAG
AAGAAGAAGAGCCGGCGGCCTGCGAATACTGCTTTCCGTCAGCAGCGTCTCAAGGCTTGGCAACCCATCTTGACG
CCCAAGACGGTGCTGCCTTTGTTCTTCACCATCGGCATCATATTCGCTCCCATCGGGGGCCTTCTCCTCTACGCC
AGCGCAAAGGTCCAGGAGATCATCATCGATTACTCAAAGTGCTTAGAACAGGCGCGGCCAGGCGTCTTCACCGAG
ATCCCCAGCAATAGGGTATACGCCGCCTTCAAGAGCAGCAACAGAACCATCGACGCAAAATGGTCAACGAACAAT
AACGTCGATGTCCTTGTGGAAAGGACGGGCGTCGAAATCATGACCAATCAATGCATCCTCGAATTCGAAATTCCC
GACAGCATGAACCCGCCCGTTCTGTTCTACTACAAGCTCACAAACTTCCATCAGAACCACCGTCGCTACGTCGAG
TCGTTCGATCAGGACCAGCTCAAAGGAGAGGCTGTCCCATTTGACAAGATCAAGACGTCCAAGTGCAATCCGCTC
TACGGCGAAGGCGATAAACCATACTACCCCTGCGGACTCATCGCCAACTCTCTCTTCAACGATACCTTTAGCTCG
CCCGTCTTGCTCAACCCCCCCGGAGCTATAGGCAACGAGACTCGCACCTATGACATGACACAACAGGGCATCGCC
TGGAGCAGCGACAAGGCTCTCTACGGCAAGACGACGTACAACTTCACCGACATCCTCCCTCCTCCGAACTGGAAG
GTTCGATATCCCGACGGCTACACGGAGAAGAATCCTCCTCCCGATCTCAAGACGGACGAGGTCTTCCAGAACTGG
ATGCGAACAGCTGCTCTGCCGTCCTTTAGCAAACTGTACCAGAGGAACGACACCGCAAGTATGGACAAAGGCCGA
TACCGCGTCACCATCAACGACTACTTCCCAACGTCGGAATACAAGGGCACCAAGTCCATCGTCATCACAACCCGC
ACCGTCATGGGAGGGCGCAACCCGTTCCTGGGCATCGCCTACCTCGTAGTCGGAGGCCTCTGCATCCTCCTCGGC
ACCATCTTCACCGTCACCCATCTCATCAAGCCCAGAAAACTGGGCGATCACACGTACCTCTCCTGGAACAAGGTT
CCCACCGCTCCCAGATCGGCTGGCGCTTCGGCTGCCATAGCTTCGGGCCGTGAGATTCGCCCCAGTGAAGCCTAG
Gene >Ophun1|1323
ATGTCCGACTCGCCTCCGGGCGCCGGCCAAGCCGACTCCATCAACTCGCACGAGTCAAGTCCCAAGCACCCGGAG
AAGAAGAAGAGCCGGCGGCCTGCGAGTGGGTGTTTTCTCGTGGCCTCATGTGTGGTTTCTGGCGCTGACGGCTTC
GTGATAGATACTGCTTTCCGTCAGCAGCGTCTCAAGGCTTGGCAGTGAGTCTGCGTTCGGTTGCTCGACGTGGTT
GGCATTGCTGAGTTGCGCGAACAGACCCATCTTGACGCCCAAGACGGTGCTGCCTTTGTTCTTCACCATCGGCAT
CATATTCGCTCCCATCGGGGGCCTTCTCCTCTACGCCAGCGCAAAGGTCCAGGAGATCATCATCGATTACTCAAA
GTGCTTAGAACAGGCGCGGCCAGGCGTCTTCACCGAGATCCCCAGCAATAGGGTATACGCCGCCTTCAAGAGCAG
CAACAGAACCATCGACGCAAAATGGTCAACGAACAATAACGTCGATGTCCTTGTGGAAAGGACGGGCGTCGAAAT
CATGACCAATCAATGCATCCTCGAATTCGAAATTCCCGACAGCATGAACCCGCCCGTTCTGTTCTACTACAAGCT
CACAAACTTCCATCAGAACCACCGTCGCTACGTCGAGTCGTTCGATCAGGACCAGCTCAAAGGAGAGGCTGTCCC
ATTTGACAAGATCAAGACGTCCAAGTGCAATCCGCTCTACGGCGAAGGCGATAAACCATACTACCCCTGCGGACT
CATCGCCAACTCTCTCTTCAACGATACCTTTAGCTCGCCCGTCTTGCTCAACCCCCCCGGAGCTATAGGCAACGA
GACTCGCACCTATGACATGACACAACAGGGCATCGCCTGGAGCAGCGACAAGGCTCTCTACGGCAAGACGACGTA
CAACTTCACCGACATCCTCCCTCCTCCGAACTGGAAGGTTCGATATCCCGACGGCTACACGGAGAAGAATCCTCC
TCCCGATCTCAAGACGGACGAGGTCTTCCAGAACTGGATGCGAACAGCTGCTCTGCCGTCCTTTAGCAAACTGTA
CCAGAGGAACGACACCGCAAGTATGGACAAAGGCCGATACCGCGTCACCATCAACGACTGTAAGAGTCAACCCGA
CTGAGCCCGACTTGTCCGTCTGCTAATCAACCTCCCCCAGACTTCCCAACGTCGGAATACAAGGGCACCAAGTCC
ATCGTCATCACAACCCGCACCGTCATGGGAGGGCGCAACCCGTTCCTGGGCATCGCCTACCTCGTAGTCGGAGGC
CTCTGCATCCTCCTCGGCACCATCTTCACCGTCACCCATCTCATCAAGCCCAGGTCAGACGAACCTCTTCCAACT
TGTTCATCCACCCACCCCCTTTCCTATAGCTGACTCTCAGGTACAGAAAACTGGGCGATCACACGTACCTCTCCT
GGAACAAGGTTCCCACCGCTCCCAGATCGGCTGGCGCTTCGGCTGCCATAGCTTCGGGCCGTGAGATTCGCCCCA
GTGAAGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail