Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1321
Gene name
LocationContig_152:3845..5409
Strand-
Gene length (bp)1564
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-25 33 202
PF07690 MFS_1 Major Facilitator Superfamily 2.3E-08 233 356

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 62 216 2.0E-27
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 55 201 8.0E-25
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 11 417 8.0E-22
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 11 216 5.0E-15
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 233 398 6.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 62 216 2.0E-27
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 55 201 8.0E-25
sp|P13090|ATR1_YEAST Aminotriazole resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATR1 PE=1 SV=2 11 417 8.0E-22
sp|Q03263|YM8M_YEAST Uncharacterized transporter YMR279C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR279C PE=1 SV=1 11 216 5.0E-15
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 233 398 6.0E-14
sp|Q9P6J7|YHD3_SCHPO Uncharacterized MFS-type transporter C1683.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.03c PE=3 SV=1 233 411 1.0E-12
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 2 190 2.0E-12
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 2 190 2.0E-12
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 45 218 9.0E-12
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 45 218 9.0E-12
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 44 186 7.0E-10
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 44 222 8.0E-10
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 44 222 8.0E-10
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 26 185 1.0E-09
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 28 196 1.0E-08
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 44 190 3.0E-08
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 44 189 3.0E-08
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 20 225 2.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 20 225 2.0E-07
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 62 208 3.0E-07
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 43 216 3.0E-07
sp|P37594|SMVA_SALTY Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=smvA PE=3 SV=2 15 184 7.0E-07
sp|D0ZXQ3|SMVA_SALT1 Methyl viologen resistance protein SmvA OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=smvA PE=1 SV=1 15 184 7.0E-07
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 26 189 2.0E-06
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 44 221 4.0E-06
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 44 221 4.0E-06
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 81 192 7.0E-06
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 77 189 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 95 117 22
3 124 141 17
4 151 173 22
5 180 202 22
6 247 269 22
7 276 293 17
8 308 330 22
9 343 365 22
10 385 407 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1321
MPPDLEKLGRERPALFANWLAEVLFVTSVVMSVVMIEYFIAGFNIVLPVVSDALTITARSRTWPAGVTNLTTAAL
LLPCSRLCDLYGSRLVFFCGHAWLIIWSLAGGFSGSTIMLIFCRAMQGIGAAAFLPSCLALLSRTYRPGPRKNII
FSIYGAFSCIGFIIGIIVGALVSEYLQWPWYFWIGALIGVFTALCGALSIPTLDDTTPGAQMDWLGLGTIVPVAG
YSNQPSSIETVMRASPLLTAAYFLPMAIGGVVLAIGGGFILHIIPNRFMMLISSLGFILQTLLWALIPEDPIKST
TFLYWAYIMPAMLAGTIGVDIAFNVGTIYITTAMPKRHQAAASGLSNSLVYLGIAFWLGITELAVSTAVQNQGDD
KGGLGEQYKVGFYVGVGLSALSLGLTLTIKIGQAKSALTADEKAERELEMTD*
Coding >Ophun1|1321
ATGCCTCCCGACCTGGAGAAACTCGGACGCGAGCGGCCGGCCTTGTTCGCCAACTGGCTGGCCGAAGTCTTATTC
GTGACTTCGGTCGTTATGAGCGTGGTGATGATCGAGTACTTCATCGCCGGCTTCAACATCGTTCTGCCCGTCGTC
TCCGATGCCCTCACCATCACTGCTCGATCACGAACCTGGCCTGCCGGTGTGACTAACCTGACAACCGCCGCGCTA
TTGCTACCGTGTTCCCGCCTCTGCGATCTTTATGGCAGTCGGCTCGTCTTCTTCTGCGGGCACGCTTGGCTCATC
ATCTGGTCCCTTGCTGGAGGCTTCAGCGGAAGCACCATCATGCTGATATTCTGCCGTGCTATGCAGGGCATCGGT
GCTGCTGCTTTTCTTCCCTCATGCCTGGCTCTTCTTTCGAGGACCTATCGTCCTGGTCCGCGTAAGAACATCATC
TTCTCTATATACGGCGCCTTCAGCTGCATCGGCTTCATCATCGGTATTATTGTAGGCGCTCTCGTTTCCGAGTAT
CTTCAGTGGCCGTGGTATTTCTGGATTGGTGCTCTTATCGGCGTCTTTACCGCTCTTTGCGGTGCTCTCTCTATC
CCGACCTTGGACGACACGACCCCTGGGGCTCAGATGGACTGGCTGGGGCTTGGGACCATCGTTCCAGTTGCTGGC
TATTCTAACCAGCCATCTAGCATCGAAACTGTTATGCGGGCAAGCCCTCTTCTCACTGCAGCTTACTTCCTACCC
ATGGCCATCGGGGGCGTGGTGCTCGCCATCGGGGGCGGCTTCATCCTCCACATTATACCCAACCGCTTCATGATG
CTGATATCGTCACTTGGCTTCATACTTCAGACCCTTCTTTGGGCTTTGATCCCCGAGGACCCGATCAAGTCGACA
ACCTTTCTCTACTGGGCCTATATAATGCCTGCTATGTTGGCTGGCACCATTGGCGTTGACATTGCCTTTAACGTC
GGAACTATTTACATAACAACGGCTATGCCCAAGCGGCACCAAGCAGCTGCCAGCGGACTGAGCAACAGTCTGGTC
TATCTCGGCATCGCCTTCTGGCTCGGAATCACCGAGCTGGCAGTTTCCACCGCAGTTCAGAATCAAGGAGACGAC
AAGGGTGGACTAGGCGAGCAGTACAAGGTTGGATTCTATGTCGGCGTCGGGCTGTCTGCTCTATCTCTGGGCTTG
ACTTTGACCATCAAGATTGGGCAGGCTAAGTCGGCGTTGACGGCAGATGAGAAAGCCGAGCGGGAGCTGGAGATG
ACAGACTAA
Transcript >Ophun1|1321
ATGCCTCCCGACCTGGAGAAACTCGGACGCGAGCGGCCGGCCTTGTTCGCCAACTGGCTGGCCGAAGTCTTATTC
GTGACTTCGGTCGTTATGAGCGTGGTGATGATCGAGTACTTCATCGCCGGCTTCAACATCGTTCTGCCCGTCGTC
TCCGATGCCCTCACCATCACTGCTCGATCACGAACCTGGCCTGCCGGTGTGACTAACCTGACAACCGCCGCGCTA
TTGCTACCGTGTTCCCGCCTCTGCGATCTTTATGGCAGTCGGCTCGTCTTCTTCTGCGGGCACGCTTGGCTCATC
ATCTGGTCCCTTGCTGGAGGCTTCAGCGGAAGCACCATCATGCTGATATTCTGCCGTGCTATGCAGGGCATCGGT
GCTGCTGCTTTTCTTCCCTCATGCCTGGCTCTTCTTTCGAGGACCTATCGTCCTGGTCCGCGTAAGAACATCATC
TTCTCTATATACGGCGCCTTCAGCTGCATCGGCTTCATCATCGGTATTATTGTAGGCGCTCTCGTTTCCGAGTAT
CTTCAGTGGCCGTGGTATTTCTGGATTGGTGCTCTTATCGGCGTCTTTACCGCTCTTTGCGGTGCTCTCTCTATC
CCGACCTTGGACGACACGACCCCTGGGGCTCAGATGGACTGGCTGGGGCTTGGGACCATCGTTCCAGTTGCTGGC
TATTCTAACCAGCCATCTAGCATCGAAACTGTTATGCGGGCAAGCCCTCTTCTCACTGCAGCTTACTTCCTACCC
ATGGCCATCGGGGGCGTGGTGCTCGCCATCGGGGGCGGCTTCATCCTCCACATTATACCCAACCGCTTCATGATG
CTGATATCGTCACTTGGCTTCATACTTCAGACCCTTCTTTGGGCTTTGATCCCCGAGGACCCGATCAAGTCGACA
ACCTTTCTCTACTGGGCCTATATAATGCCTGCTATGTTGGCTGGCACCATTGGCGTTGACATTGCCTTTAACGTC
GGAACTATTTACATAACAACGGCTATGCCCAAGCGGCACCAAGCAGCTGCCAGCGGACTGAGCAACAGTCTGGTC
TATCTCGGCATCGCCTTCTGGCTCGGAATCACCGAGCTGGCAGTTTCCACCGCAGTTCAGAATCAAGGAGACGAC
AAGGGTGGACTAGGCGAGCAGTACAAGGTTGGATTCTATGTCGGCGTCGGGCTGTCTGCTCTATCTCTGGGCTTG
ACTTTGACCATCAAGATTGGGCAGGCTAAGTCGGCGTTGACGGCAGATGAGAAAGCCGAGCGGGAGCTGGAGATG
ACAGACTAA
Gene >Ophun1|1321
ATGCCTCCCGACCTGGAGAAACTCGGACGCGAGCGGCCGGCCTTGTTCGCCAACTGGCTGGCCGAAGTCTTATTC
GTGACTTCGGTCGTTATGAGCGTGGTGATGATCGAGTACTTCATCGCCGGCTTCAACATCGTTCTGCCCGTCGTC
TCCGATGCCCTCACCATCACTGCTCGATCACGAACCTGGCCTGCCGGTGTGACTAACCTGACAACCGCCGCGCTA
TTGCTACCGTGTTCCCGCCTCTGCGATCTTTATGGCAGTCGGCTCGTCTTCTTCTGCGGGCACGCTTGGCTCATC
ATCTGGTCCCTTGCTGGAGGCTTCAGCGGAAGCACCATCATGCTGATATTCTGCCGTGCTATGCAGGGCATCGGT
GCTGCTGCTTTTCTTCCCTCATGCCTGGCTCTTCTTTCGAGGACCTATCGTCCTGGTCCGCGTAAGAACATCATC
TTCTCTATATACGGCGCCTTCAGCTGCATCGGCTTCATCATCGGTATTATTGTAGGCGCTCTCGTTTCCGAGTAT
CTTCAGTGGCCGTGGTATTTCTGGATTGGTGCTCTTATCGGCGTCTTTACCGCTCTTTGCGGTGCTCTCTCTATC
CCGACCTTGGACGACACGACCCCTGGGGCTCAGATGGACTGGCTGGGGCTTGGGACCATCGTTCCAGGTCTGGTA
CTCGTCATATTCGCCTTGACAGATGCGGGACTTGCTCCTGATGGATGGCGTACGCCTTATATATACATCACCCTC
TGCTTGGGTGTCGTCTTTCTGGCTGCCGCCGTCTACAGCCAGGGATGGGCGGCTTCCAAGCCGCTATTGCCAGGA
GATCTCTTTAAGCATCGATATATCAAGCGGCTTATCGCTGTGTTGTTTCTGTCATACGGAATTTGCGGACTCTGT
CTATTTTACGCCAGCTTCTAGTGAGTGTTTCTAACTTCCATCTACAGTTGCTGGCTATTCTAACCAGCCATCTAG
CATCGAAACTGTTATGCGGGCAAGCCCTCTTCTCACTGCAGCTTACTTCCTACCCATGGCCATCGGGGGCGTGGT
GCTCGCCATCGGGGGCGGCTTCATCCTCCACATTATACCCAACCGCTTCATGATGCTGATATCGTCACTTGGCTT
CATACTTCAGACCCTTCTTTGGGCTTTGATCCCCGAGGACCCGATCAAGTCGACAACCTTTCTCTACTGGGCCTA
TATAATGCCTGCTATGTTGGCTGGCACCATTGGCGTTGACATTGCCTTTAACGTCGGAACTATTTACATAACAAC
GGCTATGCCCAAGCGGCACCAAGCAGCTGCCAGCGGACTGAGCAACAGTCTGGTCTATCTCGGCATCGCCTTCTG
GCTCGGAATCACCGAGCTGGCAGTTTCCACCGCAGTTCAGAATCAAGGAGACGACAAGGGTGGACTAGGCGAGCA
GTACAAGGTTGGATTCTATGTCGGCGTCGGGCTGTCTGCTCTATCTCTGGGCTTGACTTTGACCATCAAGATTGG
GCAGGCTAAGTCGGCGTTGACGGCAGATGAGAAAGCCGAGCGGGAGCTGGAGATGACAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail