Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1320
Gene name
LocationContig_152:1546..3487
Strand-
Gene length (bp)1941
Transcript length (bp)1629
Coding sequence length (bp)1629
Protein length (aa) 543

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13854 Kelch_5 Kelch motif 6.7E-06 289 334

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AYG1|KLDC1_ARTBC Kelch repeat-containing protein ARB_01230 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01230 PE=1 SV=1 63 499 1.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

Domain # Start End Length
1 458 480 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1320
MVQPTPAADQDQRILRSIFISTLVRVRLICREAVDAMKHQAGSRDASLMPLFRRRATHSSKSRSYVSAVEALITF
NNTLSLPLDRSWQLGAAPYTIIDNHLPPPMNSLALWADERDRVLYRYGGEKTYGGHILLNENNHLWKFSPDGAGA
GTWSIQPPQDEAFFNNLKQSASGSSVFCEGYGVIAGGNGNQSSDYSFVNGTGPVTLPGMVVHNADTHAWTNETIT
PFPDDSSLRDPSEGFTAGQAVCVTGFGPNPMVLFLGGLSWDLETLALYDLVTKSWLWQQTFGNVPRGRANYCAVG
VRGPQGTLEVFIHGGNSATSGPLSDTYVLSLPAFTWFKLEVPAQARTDHACAVIGRRQMLISGGLLNRWDWKSDD
SWIGAHKILDMSELQLTDSYDADAAAYEPARMIKDWYNKGGMANVQWSSSQVQSAFNKTIDMRETARSTSSVTSA
PNTSSVGAIAGGTVGGIAAVLLLAIALFFIRRCGRRRRQKQESETSESEAVEPRITLDETAELETAGLNTAELET
EEKPQQLPSERQLYEVP*
Coding >Ophun1|1320
ATGGTGCAACCAACCCCTGCCGCAGATCAAGATCAGAGAATCCTACGATCCATCTTCATCTCTACTCTGGTTCGA
GTCCGGCTCATTTGCCGCGAAGCAGTCGATGCTATGAAGCACCAGGCTGGGAGCCGAGATGCTTCGTTGATGCCC
CTGTTTCGCCGCAGAGCCACGCATAGTAGTAAGTCTCGCAGCTACGTGTCCGCGGTAGAAGCACTCATTACTTTC
AATAACACGCTGTCTTTGCCACTCGACAGATCATGGCAGCTGGGCGCTGCGCCCTACACCATCATCGACAACCAC
TTGCCACCGCCGATGAACTCGCTGGCGCTCTGGGCCGACGAGAGAGACAGAGTGCTTTATCGCTACGGCGGTGAG
AAGACGTACGGCGGACATATACTCCTGAATGAAAACAATCATCTCTGGAAGTTCTCGCCAGACGGGGCCGGTGCC
GGGACTTGGTCTATCCAACCGCCCCAGGACGAGGCCTTCTTCAACAACCTCAAGCAGTCTGCTAGCGGCTCATCC
GTCTTCTGCGAGGGCTACGGAGTCATTGCCGGCGGCAACGGGAATCAATCGAGCGACTACAGCTTTGTGAACGGG
ACTGGGCCAGTGACGCTTCCGGGCATGGTAGTACACAACGCAGATACTCACGCCTGGACCAATGAGACGATAACC
CCTTTCCCAGACGATTCCAGCCTCAGAGACCCGTCAGAGGGGTTCACAGCTGGCCAGGCCGTTTGCGTGACTGGA
TTCGGTCCAAACCCCATGGTCCTGTTCCTGGGTGGCTTGAGCTGGGATTTGGAGACGCTTGCCTTGTATGATCTC
GTCACGAAGAGCTGGCTATGGCAGCAAACGTTCGGAAACGTGCCCAGAGGTCGGGCCAATTACTGCGCTGTCGGT
GTTCGGGGCCCTCAGGGGACGCTGGAAGTCTTCATCCACGGCGGTAACAGCGCCACAAGCGGTCCGCTGAGCGAC
ACATACGTCCTCTCTCTTCCGGCCTTTACCTGGTTCAAGCTCGAGGTTCCGGCGCAGGCCAGGACGGACCATGCT
TGTGCCGTCATCGGTAGGAGACAGATGCTCATCTCGGGTGGTCTTTTGAATCGCTGGGACTGGAAATCGGACGAT
TCGTGGATTGGCGCGCACAAGATACTTGATATGTCGGAGCTACAGCTGACGGACAGCTACGATGCCGACGCTGCG
GCATATGAGCCGGCAAGGATGATTAAAGATTGGTACAACAAAGGGGGAATGGCCAACGTGCAGTGGAGCAGTTCC
CAAGTTCAAAGTGCCTTCAACAAGACGATAGATATGAGGGAAACTGCGCGGTCCACATCATCAGTCACCTCTGCG
CCCAACACGTCGTCTGTTGGAGCCATAGCTGGAGGCACCGTCGGCGGCATCGCAGCAGTACTTCTTCTCGCCATA
GCCCTCTTCTTCATCCGCAGATGTGGTAGAAGAAGACGACAAAAGCAAGAGAGCGAGACGTCTGAGTCAGAAGCC
GTCGAGCCACGAATCACTCTTGACGAAACAGCGGAACTCGAGACGGCGGGACTCAATACAGCAGAGCTCGAGACA
GAGGAAAAACCGCAGCAGCTGCCTTCAGAGAGGCAACTGTACGAGGTTCCTTGA
Transcript >Ophun1|1320
ATGGTGCAACCAACCCCTGCCGCAGATCAAGATCAGAGAATCCTACGATCCATCTTCATCTCTACTCTGGTTCGA
GTCCGGCTCATTTGCCGCGAAGCAGTCGATGCTATGAAGCACCAGGCTGGGAGCCGAGATGCTTCGTTGATGCCC
CTGTTTCGCCGCAGAGCCACGCATAGTAGTAAGTCTCGCAGCTACGTGTCCGCGGTAGAAGCACTCATTACTTTC
AATAACACGCTGTCTTTGCCACTCGACAGATCATGGCAGCTGGGCGCTGCGCCCTACACCATCATCGACAACCAC
TTGCCACCGCCGATGAACTCGCTGGCGCTCTGGGCCGACGAGAGAGACAGAGTGCTTTATCGCTACGGCGGTGAG
AAGACGTACGGCGGACATATACTCCTGAATGAAAACAATCATCTCTGGAAGTTCTCGCCAGACGGGGCCGGTGCC
GGGACTTGGTCTATCCAACCGCCCCAGGACGAGGCCTTCTTCAACAACCTCAAGCAGTCTGCTAGCGGCTCATCC
GTCTTCTGCGAGGGCTACGGAGTCATTGCCGGCGGCAACGGGAATCAATCGAGCGACTACAGCTTTGTGAACGGG
ACTGGGCCAGTGACGCTTCCGGGCATGGTAGTACACAACGCAGATACTCACGCCTGGACCAATGAGACGATAACC
CCTTTCCCAGACGATTCCAGCCTCAGAGACCCGTCAGAGGGGTTCACAGCTGGCCAGGCCGTTTGCGTGACTGGA
TTCGGTCCAAACCCCATGGTCCTGTTCCTGGGTGGCTTGAGCTGGGATTTGGAGACGCTTGCCTTGTATGATCTC
GTCACGAAGAGCTGGCTATGGCAGCAAACGTTCGGAAACGTGCCCAGAGGTCGGGCCAATTACTGCGCTGTCGGT
GTTCGGGGCCCTCAGGGGACGCTGGAAGTCTTCATCCACGGCGGTAACAGCGCCACAAGCGGTCCGCTGAGCGAC
ACATACGTCCTCTCTCTTCCGGCCTTTACCTGGTTCAAGCTCGAGGTTCCGGCGCAGGCCAGGACGGACCATGCT
TGTGCCGTCATCGGTAGGAGACAGATGCTCATCTCGGGTGGTCTTTTGAATCGCTGGGACTGGAAATCGGACGAT
TCGTGGATTGGCGCGCACAAGATACTTGATATGTCGGAGCTACAGCTGACGGACAGCTACGATGCCGACGCTGCG
GCATATGAGCCGGCAAGGATGATTAAAGATTGGTACAACAAAGGGGGAATGGCCAACGTGCAGTGGAGCAGTTCC
CAAGTTCAAAGTGCCTTCAACAAGACGATAGATATGAGGGAAACTGCGCGGTCCACATCATCAGTCACCTCTGCG
CCCAACACGTCGTCTGTTGGAGCCATAGCTGGAGGCACCGTCGGCGGCATCGCAGCAGTACTTCTTCTCGCCATA
GCCCTCTTCTTCATCCGCAGATGTGGTAGAAGAAGACGACAAAAGCAAGAGAGCGAGACGTCTGAGTCAGAAGCC
GTCGAGCCACGAATCACTCTTGACGAAACAGCGGAACTCGAGACGGCGGGACTCAATACAGCAGAGCTCGAGACA
GAGGAAAAACCGCAGCAGCTGCCTTCAGAGAGGCAACTGTACGAGGTTCCTTGA
Gene >Ophun1|1320
ATGGTGCAACCAACCCCTGCCGCAGATCAAGATCAGAGAATCCTACGATCCATCTTCATCTCTACTCTGGTTCGA
GTCCGGCTCATTTGCCGCGAAGCAGTCGATGCTATGAAGCACCAGGCTGGGAGCCGAGATGCTTCGTTGATGCCC
CTGTTTCGCCGCAGAGCCACGCATAGTAGTAAGTCTCGCAGCTACGTGTCCGCGGTAGAAGCACTCATTACTTGT
CAGTTGTCGTTCTGGATAAGTTCCTTTATCTCGAAGGAGGCGAGGTGTCGTCGTATAACAAGGGCGAGCAGATGG
GTGAAAAAGCATCTTTTACTGGTGAATTGAAGCTCTCTTCCCCGGCTACTGTCGTACTGCTTCTAACATATCTTC
ATAGTCAATAACACGCTGTCTTTGCCACTCGACAGATCATGGCAGCTGGGCGCTGCGCCCTACACCATCATCGAC
AACCACTTGCCACCGCCGATGAACTCGCTGGCGCTCTGGGCCGACGAGAGAGACAGAGTGCTTTATCGCTACGGC
GGTGAGAAGACGTACGGCGGACATATACTCCTGAATGAAAACAATCATCTCTGGAAGTTCTCGCCAGACGGGGCC
GGTGCCGGGACTTGGTCTATCCAACCGCCCCAGGACGAGGCCTTCTTCAACAACCTCAAGCAGTCTGCTAGCGGC
TCATCCGTCTTCTGCGAGGGCTACGGAGTCATTGCCGGCGGCAACGGGAATCAATCGAGCGACTACAGCTTTGTG
AACGGGACTGGGCCAGTGACGCTTCCGGGCATGGTAGTACACAACGCAGATACTCACGCCTGGACCAATGAGACG
ATAACCCCTTTCCCAGACGATTCCAGCCTCAGAGACCCGTCAGAGGGGTTCACAGCTGGCCAGGCCGTTTGCGTG
ACTGGATTCGGTCCAAACCCCATGGTCCTGTTCCTGGGTGGCTTGAGCTGGGATTTGGAGACGCTTGCCTTGTAT
GATCTCGTCACGAAGAGCTGGCTATGGCAGCAAACGTTCGGAAACGTGCCCAGAGGTCGGGCCAATTACTGCGCT
GTCGGTGTTCGGGGCCCTCAGGGGACGCTGGAAGTGTAAGTCGACCAACGTTCCAGCTAAGAAGGGACTCTAAGA
CGGCTCTCAGCTTCATCCACGGCGGTAACAGCGCCACAAGCGGTCCGCTGAGCGACACATACGTCCTCTCTCTTC
CGGCCTTTACCTGGTTCAAGCTCGAGGTTCCGGCGCAGGCCAGGACGGACCATGCTTGTGCCGTCATCGGTAGGA
GACAGATGCTCATCTCGGGTGGTCTTTTGAATCGCTGGGACTGGAAATCGGACGATTCGTGGATTGGCGCGCACA
AGATACTTGATATGTCGGAGCTACAGCTGACGGACAGCTACGATGCCGACGCTGCGGCATATGAGCCGGCAAGGA
TGATTAAAGATTGGTACAACAAAGGGTTAGTTGGCTTCTTGCGTCTCTTCTCTTGTTCTAGAGTTCTGATCAGCC
GCAGGGGAATGGCCAACGTGCAGTGGAGCAGTTCCCAAGTTCAAAGTGCCTTCAACAAGACGATAGATATGAGGG
AAACTGCGCGTAAGTGGTGGGAAGCAGAACATGGGATCTTGCTGATGATATCAACTTCTAGGGTCCACATCATCA
GTCACCTCTGCGCCCAACACGTCGTCTGTTGGAGCCATAGCTGGAGGCACCGTCGGCGGCATCGCAGCAGTACTT
CTTCTCGCCATAGCCCTCTTCTTCATCCGCAGATGTGGTAGAAGAAGACGACAAAAGCAAGAGAGCGAGACGTCT
GAGTCAGAAGCCGTCGAGCCACGAATCACTCTTGACGAAACAGCGGAACTCGAGACGGCGGGACTCAATACAGCA
GAGCTCGAGACAGAGGAAAAACCGCAGCAGCTGCCTTCAGAGAGGCAACTGTACGAGGTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail