Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|131
Gene name
LocationContig_101:26461..28243
Strand+
Gene length (bp)1782
Transcript length (bp)1782
Coding sequence length (bp)1782
Protein length (aa) 594

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.999773

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6072
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|131 (this protein)
Ophiocordyceps kimflemingae Ophio5|5679
Ophiocordyceps subramaniannii Hirsu2|2554
Ophiocordyceps subramaniannii Hirsu2|2979

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|131
MKLTIYLPLLLLLLPPTTPLDPYLDLNPPQTVDSEPPTLLPISNPNLDPTAPRNSVPTRLLSMLWAQDQGPGTVR
VHSRMRWPTVLLEDIGAVTGVVCSDGLLDVGFDRDEALMMAWEAWRRLHRFVVVTNALGGCDAPAERGVYRASGK
AIVLDPSGRRLRVQAERIRYGDAARASDVTLRSVRMPAHPRPGRRNQHGHWKRAATSFHQSLDMSGLELFRLGNT
SLIADRLHLDASLSLSGKLRLGFFTVAECWFDISGTAGLDLSLALQVDAQLQRTLDRSTPALTLPLVAIPGIVAV
GPAVRLAVGVDVTALASLYAEASLRVDFVRVGWHVDLVDGSKSRSTGLMPTFDAAVRLGGKASLHLDPFVDVRFL
LNVQFLSGLWDLNGGIKVVPRIANAFSIDAGEAFPAGGLPSGPSEPEESPDGPLSFVLLQDGKPREASPRHGYDV
NNNNNNNNDDINKMRINNWKPLFPQSQKSKKRKSKKYNPQSLTPKIPKPLRPRPAPLTLITPRSETTQAEEQQEA
SRKAKEGRRKASEVAVACRDGISLKSEFRLDVSAVLASWEWNLYRKSVPFYEGCYALPAGSLMLMPPP*
Coding >Ophun1|131
ATGAAGCTCACCATCTACCTCCCTCTCCTCCTCCTCCTCCTCCCCCCAACAACCCCCCTAGACCCCTATCTAGAC
CTCAACCCCCCCCAAACCGTCGACAGCGAACCCCCAACCCTCCTCCCCATCAGCAACCCCAACCTCGACCCCACA
GCGCCCCGGAACAGCGTGCCAACCCGCCTCCTCTCCATGCTATGGGCCCAAGACCAAGGCCCAGGAACAGTCCGC
GTCCACAGCCGAATGCGCTGGCCGACGGTGCTCCTCGAAGACATTGGCGCCGTCACGGGCGTCGTCTGCAGCGAT
GGCTTGCTGGACGTGGGCTTCGACAGGGACGAGGCCTTGATGATGGCTTGGGAGGCTTGGAGGCGGCTTCACAGA
TTCGTCGTCGTTACTAATGCGCTGGGCGGGTGTGATGCTCCGGCTGAGAGGGGGGTTTATCGTGCGAGTGGCAAG
GCCATCGTCTTGGATCCATCCGGACGGAGACTCCGGGTTCAGGCCGAGAGGATCCGCTACGGAGACGCGGCGCGG
GCTTCGGACGTGACACTCCGATCCGTCCGGATGCCGGCCCACCCCCGGCCCGGACGCCGAAACCAACACGGACAC
TGGAAACGGGCAGCAACAAGCTTCCACCAAAGCCTCGACATGTCAGGGCTCGAACTCTTCCGCCTGGGAAACACG
TCCCTCATCGCCGACCGTCTGCACCTGGACGCCAGCCTCAGCCTCTCGGGCAAGCTCCGGCTCGGCTTCTTCACC
GTGGCGGAATGCTGGTTCGACATCTCGGGCACGGCGGGTCTGGACCTCTCGCTGGCGCTGCAGGTAGACGCCCAG
CTTCAGCGGACGCTGGATCGGTCCACGCCCGCGCTGACGCTGCCTCTCGTCGCCATCCCGGGTATCGTGGCGGTT
GGGCCGGCGGTGAGGCTCGCTGTTGGCGTCGACGTCACCGCCCTGGCATCTCTGTACGCCGAGGCGTCGCTGAGG
GTTGATTTCGTGCGGGTGGGATGGCATGTTGATCTTGTGGATGGGTCAAAGTCTAGGTCTACCGGGTTGATGCCT
ACCTTTGACGCTGCGGTGCGACTCGGGGGCAAGGCGTCGCTTCACCTCGATCCCTTTGTCGACGTGCGCTTCCTG
CTCAACGTGCAGTTCCTCTCCGGGCTTTGGGATCTCAACGGGGGCATCAAGGTGGTGCCAAGGATTGCCAATGCC
TTTAGCATCGATGCTGGAGAGGCGTTTCCCGCGGGTGGGCTTCCGAGCGGGCCGTCTGAGCCGGAGGAGAGTCCA
GACGGGCCTTTGTCTTTTGTGTTGCTTCAGGACGGGAAGCCACGTGAAGCGTCCCCGAGACATGGATACGACGTC
AACAACAACAACAACAACAACAATGACGACATCAACAAGATGAGAATCAACAACTGGAAACCCCTCTTCCCCCAA
AGCCAAAAGTCGAAGAAGCGCAAGTCAAAGAAATACAACCCCCAATCCCTAACCCCCAAGATCCCCAAACCCTTA
CGCCCCCGTCCCGCACCCCTAACCCTGATAACCCCCCGAAGCGAGACGACACAAGCAGAGGAGCAGCAGGAAGCC
AGCCGCAAGGCCAAAGAAGGCAGACGCAAGGCGAGCGAGGTGGCCGTCGCCTGCAGGGATGGCATCTCCCTCAAG
AGCGAGTTTCGTCTTGACGTCAGTGCCGTGCTGGCCAGCTGGGAGTGGAATCTCTATCGCAAGAGCGTGCCGTTT
TACGAGGGGTGTTATGCTCTGCCGGCGGGGAGTTTGATGCTGATGCCTCCTCCGTGA
Transcript >Ophun1|131
ATGAAGCTCACCATCTACCTCCCTCTCCTCCTCCTCCTCCTCCCCCCAACAACCCCCCTAGACCCCTATCTAGAC
CTCAACCCCCCCCAAACCGTCGACAGCGAACCCCCAACCCTCCTCCCCATCAGCAACCCCAACCTCGACCCCACA
GCGCCCCGGAACAGCGTGCCAACCCGCCTCCTCTCCATGCTATGGGCCCAAGACCAAGGCCCAGGAACAGTCCGC
GTCCACAGCCGAATGCGCTGGCCGACGGTGCTCCTCGAAGACATTGGCGCCGTCACGGGCGTCGTCTGCAGCGAT
GGCTTGCTGGACGTGGGCTTCGACAGGGACGAGGCCTTGATGATGGCTTGGGAGGCTTGGAGGCGGCTTCACAGA
TTCGTCGTCGTTACTAATGCGCTGGGCGGGTGTGATGCTCCGGCTGAGAGGGGGGTTTATCGTGCGAGTGGCAAG
GCCATCGTCTTGGATCCATCCGGACGGAGACTCCGGGTTCAGGCCGAGAGGATCCGCTACGGAGACGCGGCGCGG
GCTTCGGACGTGACACTCCGATCCGTCCGGATGCCGGCCCACCCCCGGCCCGGACGCCGAAACCAACACGGACAC
TGGAAACGGGCAGCAACAAGCTTCCACCAAAGCCTCGACATGTCAGGGCTCGAACTCTTCCGCCTGGGAAACACG
TCCCTCATCGCCGACCGTCTGCACCTGGACGCCAGCCTCAGCCTCTCGGGCAAGCTCCGGCTCGGCTTCTTCACC
GTGGCGGAATGCTGGTTCGACATCTCGGGCACGGCGGGTCTGGACCTCTCGCTGGCGCTGCAGGTAGACGCCCAG
CTTCAGCGGACGCTGGATCGGTCCACGCCCGCGCTGACGCTGCCTCTCGTCGCCATCCCGGGTATCGTGGCGGTT
GGGCCGGCGGTGAGGCTCGCTGTTGGCGTCGACGTCACCGCCCTGGCATCTCTGTACGCCGAGGCGTCGCTGAGG
GTTGATTTCGTGCGGGTGGGATGGCATGTTGATCTTGTGGATGGGTCAAAGTCTAGGTCTACCGGGTTGATGCCT
ACCTTTGACGCTGCGGTGCGACTCGGGGGCAAGGCGTCGCTTCACCTCGATCCCTTTGTCGACGTGCGCTTCCTG
CTCAACGTGCAGTTCCTCTCCGGGCTTTGGGATCTCAACGGGGGCATCAAGGTGGTGCCAAGGATTGCCAATGCC
TTTAGCATCGATGCTGGAGAGGCGTTTCCCGCGGGTGGGCTTCCGAGCGGGCCGTCTGAGCCGGAGGAGAGTCCA
GACGGGCCTTTGTCTTTTGTGTTGCTTCAGGACGGGAAGCCACGTGAAGCGTCCCCGAGACATGGATACGACGTC
AACAACAACAACAACAACAACAATGACGACATCAACAAGATGAGAATCAACAACTGGAAACCCCTCTTCCCCCAA
AGCCAAAAGTCGAAGAAGCGCAAGTCAAAGAAATACAACCCCCAATCCCTAACCCCCAAGATCCCCAAACCCTTA
CGCCCCCGTCCCGCACCCCTAACCCTGATAACCCCCCGAAGCGAGACGACACAAGCAGAGGAGCAGCAGGAAGCC
AGCCGCAAGGCCAAAGAAGGCAGACGCAAGGCGAGCGAGGTGGCCGTCGCCTGCAGGGATGGCATCTCCCTCAAG
AGCGAGTTTCGTCTTGACGTCAGTGCCGTGCTGGCCAGCTGGGAGTGGAATCTCTATCGCAAGAGCGTGCCGTTT
TACGAGGGGTGTTATGCTCTGCCGGCGGGGAGTTTGATGCTGATGCCTCCTCCGTGA
Gene >Ophun1|131
ATGAAGCTCACCATCTACCTCCCTCTCCTCCTCCTCCTCCTCCCCCCAACAACCCCCCTAGACCCCTATCTAGAC
CTCAACCCCCCCCAAACCGTCGACAGCGAACCCCCAACCCTCCTCCCCATCAGCAACCCCAACCTCGACCCCACA
GCGCCCCGGAACAGCGTGCCAACCCGCCTCCTCTCCATGCTATGGGCCCAAGACCAAGGCCCAGGAACAGTCCGC
GTCCACAGCCGAATGCGCTGGCCGACGGTGCTCCTCGAAGACATTGGCGCCGTCACGGGCGTCGTCTGCAGCGAT
GGCTTGCTGGACGTGGGCTTCGACAGGGACGAGGCCTTGATGATGGCTTGGGAGGCTTGGAGGCGGCTTCACAGA
TTCGTCGTCGTTACTAATGCGCTGGGCGGGTGTGATGCTCCGGCTGAGAGGGGGGTTTATCGTGCGAGTGGCAAG
GCCATCGTCTTGGATCCATCCGGACGGAGACTCCGGGTTCAGGCCGAGAGGATCCGCTACGGAGACGCGGCGCGG
GCTTCGGACGTGACACTCCGATCCGTCCGGATGCCGGCCCACCCCCGGCCCGGACGCCGAAACCAACACGGACAC
TGGAAACGGGCAGCAACAAGCTTCCACCAAAGCCTCGACATGTCAGGGCTCGAACTCTTCCGCCTGGGAAACACG
TCCCTCATCGCCGACCGTCTGCACCTGGACGCCAGCCTCAGCCTCTCGGGCAAGCTCCGGCTCGGCTTCTTCACC
GTGGCGGAATGCTGGTTCGACATCTCGGGCACGGCGGGTCTGGACCTCTCGCTGGCGCTGCAGGTAGACGCCCAG
CTTCAGCGGACGCTGGATCGGTCCACGCCCGCGCTGACGCTGCCTCTCGTCGCCATCCCGGGTATCGTGGCGGTT
GGGCCGGCGGTGAGGCTCGCTGTTGGCGTCGACGTCACCGCCCTGGCATCTCTGTACGCCGAGGCGTCGCTGAGG
GTTGATTTCGTGCGGGTGGGATGGCATGTTGATCTTGTGGATGGGTCAAAGTCTAGGTCTACCGGGTTGATGCCT
ACCTTTGACGCTGCGGTGCGACTCGGGGGCAAGGCGTCGCTTCACCTCGATCCCTTTGTCGACGTGCGCTTCCTG
CTCAACGTGCAGTTCCTCTCCGGGCTTTGGGATCTCAACGGGGGCATCAAGGTGGTGCCAAGGATTGCCAATGCC
TTTAGCATCGATGCTGGAGAGGCGTTTCCCGCGGGTGGGCTTCCGAGCGGGCCGTCTGAGCCGGAGGAGAGTCCA
GACGGGCCTTTGTCTTTTGTGTTGCTTCAGGACGGGAAGCCACGTGAAGCGTCCCCGAGACATGGATACGACGTC
AACAACAACAACAACAACAACAATGACGACATCAACAAGATGAGAATCAACAACTGGAAACCCCTCTTCCCCCAA
AGCCAAAAGTCGAAGAAGCGCAAGTCAAAGAAATACAACCCCCAATCCCTAACCCCCAAGATCCCCAAACCCTTA
CGCCCCCGTCCCGCACCCCTAACCCTGATAACCCCCCGAAGCGAGACGACACAAGCAGAGGAGCAGCAGGAAGCC
AGCCGCAAGGCCAAAGAAGGCAGACGCAAGGCGAGCGAGGTGGCCGTCGCCTGCAGGGATGGCATCTCCCTCAAG
AGCGAGTTTCGTCTTGACGTCAGTGCCGTGCTGGCCAGCTGGGAGTGGAATCTCTATCGCAAGAGCGTGCCGTTT
TACGAGGGGTGTTATGCTCTGCCGGCGGGGAGTTTGATGCTGATGCCTCCTCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail