Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1288
Gene name
LocationContig_150:18148..19234
Strand+
Gene length (bp)1086
Transcript length (bp)1086
Coding sequence length (bp)1086
Protein length (aa) 362

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04000 Sas10_Utp3 Sas10/Utp3/C1D family 6.2E-17 10 93

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09713|YA36_SCHPO Uncharacterized protein C18B11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.06 PE=1 SV=1 40 344 9.0E-23
sp|P40079|LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCP5 PE=1 SV=1 1 295 1.0E-17
sp|Q6PFJ1|NGDN_DANRE Neuroguidin OS=Danio rerio GN=ngdn PE=2 SV=1 1 267 3.0E-09
sp|Q5M985|NGDNB_XENLA Neuroguidin-B (Fragment) OS=Xenopus laevis GN=ngdn-b PE=1 SV=1 1 113 4.0E-08
sp|Q4KLC4|NGDNA_XENLA Neuroguidin-A OS=Xenopus laevis GN=ngdn-a PE=1 SV=1 1 113 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09713|YA36_SCHPO Uncharacterized protein C18B11.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC18B11.06 PE=1 SV=1 40 344 9.0E-23
sp|P40079|LCP5_YEAST U3 small nucleolar ribonucleoprotein protein LCP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LCP5 PE=1 SV=1 1 295 1.0E-17
sp|Q6PFJ1|NGDN_DANRE Neuroguidin OS=Danio rerio GN=ngdn PE=2 SV=1 1 267 3.0E-09
sp|Q5M985|NGDNB_XENLA Neuroguidin-B (Fragment) OS=Xenopus laevis GN=ngdn-b PE=1 SV=1 1 113 4.0E-08
sp|Q4KLC4|NGDNA_XENLA Neuroguidin-A OS=Xenopus laevis GN=ngdn-a PE=1 SV=1 1 113 1.0E-07
sp|Q8NEJ9|NGDN_HUMAN Neuroguidin OS=Homo sapiens GN=NGDN PE=1 SV=1 34 113 1.0E-07
sp|Q28IV8|NGDN_XENTR Neuroguidin OS=Xenopus tropicalis GN=ngdn PE=2 SV=1 1 280 1.0E-07
sp|Q2KII6|NGDN_BOVIN Neuroguidin OS=Bos taurus GN=NGDN PE=2 SV=1 5 113 3.0E-07
sp|Q9DB96|NGDN_MOUSE Neuroguidin OS=Mus musculus GN=Ngdn PE=1 SV=1 34 113 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2865
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2933
Ophiocordyceps australis map64 (Brazil) OphauB2|4618
Ophiocordyceps camponoti-floridani Ophcf2|02909
Ophiocordyceps camponoti-rufipedis Ophun1|1288 (this protein)
Ophiocordyceps kimflemingae Ophio5|5825
Ophiocordyceps subramaniannii Hirsu2|4736

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1288
MTTLAALLGSLTQSLSLAQETTPAIASIEHPKDGISLLDVKNELLLSYLQNLVFLILLKLRNTKTAGKGSDQAVG
IDESVRAKLVELRLYLEKGARPLEEKLKFSIERFLRTAEDAQREEQSKSREGESAASDESGSESGTGSDEEEEER
PVRRHPPAAPRPGALIDDVTAQSAGRDDDDGPSGIYRPPKRDRHLMETTRPREKTDRRPNKSHTMEEFVHSELST
APMAEPSIGTTIVQGGRKMKTAQERKDEAERREYEEMNLVRLPKPSKKERAKKNKEAGNNGRMQFGGEDWRDLGE
GVDRIDRLTKRKGQAGGSVRALLDKSRKRGLDVTDGHAEIGERYQKKVKMLEAGRRRGKKR*
Coding >Ophun1|1288
ATGACGACGCTGGCCGCTTTGCTGGGCTCGCTGACGCAGTCGCTTTCACTCGCGCAAGAGACGACGCCAGCCATT
GCATCCATTGAGCATCCCAAGGATGGCATCTCTCTTCTCGATGTTAAGAACGAACTGCTTCTCTCCTATCTTCAA
AACCTCGTCTTCCTGATTCTGCTGAAGCTTCGAAACACGAAGACGGCGGGCAAAGGCAGCGACCAGGCTGTCGGG
ATTGACGAGTCTGTACGGGCAAAGCTTGTCGAGTTACGTCTCTACCTTGAAAAGGGTGCGCGACCACTCGAGGAG
AAGCTCAAGTTTTCTATCGAGCGCTTCCTCAGAACGGCCGAGGATGCGCAGCGCGAGGAGCAAAGCAAGTCTCGC
GAGGGCGAATCTGCAGCAAGTGACGAGTCCGGCTCAGAGTCAGGCACAGGAAGCGATGAGGAGGAGGAAGAGCGC
CCGGTACGCAGACATCCGCCGGCTGCCCCCAGGCCGGGCGCCTTGATCGACGACGTGACGGCGCAGTCGGCGGGA
CGCGACGATGACGACGGACCATCCGGCATTTACCGTCCCCCGAAGCGAGACCGTCATTTAATGGAAACTACTCGG
CCGCGTGAAAAGACAGACCGCAGGCCCAATAAGTCGCACACGATGGAGGAGTTTGTCCATTCAGAACTCTCCACG
GCCCCCATGGCCGAGCCCAGCATCGGCACAACTATCGTCCAGGGCGGACGCAAGATGAAGACGGCACAGGAGCGC
AAGGACGAGGCCGAGCGGCGCGAATACGAGGAGATGAACCTGGTCCGACTGCCCAAGCCGAGCAAGAAGGAACGC
GCCAAGAAGAACAAGGAGGCCGGCAACAACGGGCGCATGCAGTTCGGCGGCGAGGACTGGAGGGATCTGGGTGAG
GGCGTCGACCGTATCGATCGACTCACCAAGCGCAAGGGCCAGGCAGGCGGCAGCGTGCGAGCGCTGCTGGACAAG
AGTCGGAAACGTGGGCTGGACGTGACGGACGGCCACGCCGAGATCGGAGAGCGGTATCAGAAGAAGGTCAAGATG
CTGGAGGCTGGAAGACGCCGAGGGAAGAAGAGGTAG
Transcript >Ophun1|1288
ATGACGACGCTGGCCGCTTTGCTGGGCTCGCTGACGCAGTCGCTTTCACTCGCGCAAGAGACGACGCCAGCCATT
GCATCCATTGAGCATCCCAAGGATGGCATCTCTCTTCTCGATGTTAAGAACGAACTGCTTCTCTCCTATCTTCAA
AACCTCGTCTTCCTGATTCTGCTGAAGCTTCGAAACACGAAGACGGCGGGCAAAGGCAGCGACCAGGCTGTCGGG
ATTGACGAGTCTGTACGGGCAAAGCTTGTCGAGTTACGTCTCTACCTTGAAAAGGGTGCGCGACCACTCGAGGAG
AAGCTCAAGTTTTCTATCGAGCGCTTCCTCAGAACGGCCGAGGATGCGCAGCGCGAGGAGCAAAGCAAGTCTCGC
GAGGGCGAATCTGCAGCAAGTGACGAGTCCGGCTCAGAGTCAGGCACAGGAAGCGATGAGGAGGAGGAAGAGCGC
CCGGTACGCAGACATCCGCCGGCTGCCCCCAGGCCGGGCGCCTTGATCGACGACGTGACGGCGCAGTCGGCGGGA
CGCGACGATGACGACGGACCATCCGGCATTTACCGTCCCCCGAAGCGAGACCGTCATTTAATGGAAACTACTCGG
CCGCGTGAAAAGACAGACCGCAGGCCCAATAAGTCGCACACGATGGAGGAGTTTGTCCATTCAGAACTCTCCACG
GCCCCCATGGCCGAGCCCAGCATCGGCACAACTATCGTCCAGGGCGGACGCAAGATGAAGACGGCACAGGAGCGC
AAGGACGAGGCCGAGCGGCGCGAATACGAGGAGATGAACCTGGTCCGACTGCCCAAGCCGAGCAAGAAGGAACGC
GCCAAGAAGAACAAGGAGGCCGGCAACAACGGGCGCATGCAGTTCGGCGGCGAGGACTGGAGGGATCTGGGTGAG
GGCGTCGACCGTATCGATCGACTCACCAAGCGCAAGGGCCAGGCAGGCGGCAGCGTGCGAGCGCTGCTGGACAAG
AGTCGGAAACGTGGGCTGGACGTGACGGACGGCCACGCCGAGATCGGAGAGCGGTATCAGAAGAAGGTCAAGATG
CTGGAGGCTGGAAGACGCCGAGGGAAGAAGAGGTAG
Gene >Ophun1|1288
ATGACGACGCTGGCCGCTTTGCTGGGCTCGCTGACGCAGTCGCTTTCACTCGCGCAAGAGACGACGCCAGCCATT
GCATCCATTGAGCATCCCAAGGATGGCATCTCTCTTCTCGATGTTAAGAACGAACTGCTTCTCTCCTATCTTCAA
AACCTCGTCTTCCTGATTCTGCTGAAGCTTCGAAACACGAAGACGGCGGGCAAAGGCAGCGACCAGGCTGTCGGG
ATTGACGAGTCTGTACGGGCAAAGCTTGTCGAGTTACGTCTCTACCTTGAAAAGGGTGCGCGACCACTCGAGGAG
AAGCTCAAGTTTTCTATCGAGCGCTTCCTCAGAACGGCCGAGGATGCGCAGCGCGAGGAGCAAAGCAAGTCTCGC
GAGGGCGAATCTGCAGCAAGTGACGAGTCCGGCTCAGAGTCAGGCACAGGAAGCGATGAGGAGGAGGAAGAGCGC
CCGGTACGCAGACATCCGCCGGCTGCCCCCAGGCCGGGCGCCTTGATCGACGACGTGACGGCGCAGTCGGCGGGA
CGCGACGATGACGACGGACCATCCGGCATTTACCGTCCCCCGAAGCGAGACCGTCATTTAATGGAAACTACTCGG
CCGCGTGAAAAGACAGACCGCAGGCCCAATAAGTCGCACACGATGGAGGAGTTTGTCCATTCAGAACTCTCCACG
GCCCCCATGGCCGAGCCCAGCATCGGCACAACTATCGTCCAGGGCGGACGCAAGATGAAGACGGCACAGGAGCGC
AAGGACGAGGCCGAGCGGCGCGAATACGAGGAGATGAACCTGGTCCGACTGCCCAAGCCGAGCAAGAAGGAACGC
GCCAAGAAGAACAAGGAGGCCGGCAACAACGGGCGCATGCAGTTCGGCGGCGAGGACTGGAGGGATCTGGGTGAG
GGCGTCGACCGTATCGATCGACTCACCAAGCGCAAGGGCCAGGCAGGCGGCAGCGTGCGAGCGCTGCTGGACAAG
AGTCGGAAACGTGGGCTGGACGTGACGGACGGCCACGCCGAGATCGGAGAGCGGTATCAGAAGAAGGTCAAGATG
CTGGAGGCTGGAAGACGCCGAGGGAAGAAGAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail