Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1287
Gene name
LocationContig_150:15960..17934
Strand-
Gene length (bp)1974
Transcript length (bp)1920
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02990 EMP70 Endomembrane protein 70 1.1E-201 57 595

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 2 639 0.0E+00
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 12 639 3.0E-175
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 17 639 3.0E-172
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 7 639 9.0E-172
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 15 639 7.0E-170
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32802|TMN1_YEAST Transmembrane 9 superfamily member 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMP70 PE=1 SV=2 2 639 0.0E+00
sp|Q04562|TMN2_YEAST Transmembrane 9 superfamily member 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN2 PE=1 SV=1 12 639 3.0E-175
sp|Q9LIC2|TMN7_ARATH Transmembrane 9 superfamily member 7 OS=Arabidopsis thaliana GN=TMN7 PE=2 SV=1 17 639 3.0E-172
sp|Q9C720|TMN6_ARATH Transmembrane 9 superfamily member 6 OS=Arabidopsis thaliana GN=TMN6 PE=2 SV=1 7 639 9.0E-172
sp|Q66HG5|TM9S2_RAT Transmembrane 9 superfamily member 2 OS=Rattus norvegicus GN=Tm9sf2 PE=2 SV=1 15 639 7.0E-170
sp|Q99805|TM9S2_HUMAN Transmembrane 9 superfamily member 2 OS=Homo sapiens GN=TM9SF2 PE=1 SV=1 15 639 1.0E-169
sp|P58021|TM9S2_MOUSE Transmembrane 9 superfamily member 2 OS=Mus musculus GN=Tm9sf2 PE=1 SV=1 15 639 3.0E-168
sp|Q5R8Y6|TM9S2_PONAB Transmembrane 9 superfamily member 2 OS=Pongo abelii GN=TM9SF2 PE=2 SV=1 15 639 6.0E-167
sp|Q8RWW1|TMN10_ARATH Transmembrane 9 superfamily member 10 OS=Arabidopsis thaliana GN=TMN10 PE=2 SV=1 10 639 5.0E-162
sp|Q9Y819|YON8_SCHPO Transmembrane 9 superfamily protein C1105.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1105.08 PE=3 SV=1 11 639 4.0E-160
sp|Q92544|TM9S4_HUMAN Transmembrane 9 superfamily member 4 OS=Homo sapiens GN=TM9SF4 PE=1 SV=2 7 639 2.0E-159
sp|Q5RDY2|TM9S4_PONAB Transmembrane 9 superfamily member 4 OS=Pongo abelii GN=TM9SF4 PE=2 SV=1 7 639 3.0E-159
sp|A5D7E2|TM9S4_BOVIN Transmembrane 9 superfamily member 4 OS=Bos taurus GN=TM9SF4 PE=2 SV=2 7 639 6.0E-159
sp|Q8BH24|TM9S4_MOUSE Transmembrane 9 superfamily member 4 OS=Mus musculus GN=Tm9sf4 PE=1 SV=1 4 639 2.0E-158
sp|Q4KLL4|TM9S4_RAT Transmembrane 9 superfamily member 4 OS=Rattus norvegicus GN=Tm9sf4 PE=2 SV=1 4 639 6.0E-158
sp|F4KIB2|TMN8_ARATH Transmembrane 9 superfamily member 8 OS=Arabidopsis thaliana GN=TMN8 PE=2 SV=1 15 639 5.0E-157
sp|Q9C5N2|TMN9_ARATH Transmembrane 9 superfamily member 9 OS=Arabidopsis thaliana GN=TMN9 PE=2 SV=1 15 639 6.0E-155
sp|Q55FP0|PHG1A_DICDI Putative phagocytic receptor 1a OS=Dictyostelium discoideum GN=phg1a PE=2 SV=1 18 639 1.0E-147
sp|Q9FYQ8|TMN11_ARATH Transmembrane 9 superfamily member 11 OS=Arabidopsis thaliana GN=TMN11 PE=2 SV=1 14 639 4.0E-128
sp|F4JRE0|TMN12_ARATH Transmembrane 9 superfamily member 12 OS=Arabidopsis thaliana GN=TMN12 PE=2 SV=1 15 639 3.0E-111
sp|Q9ZPS7|TMN3_ARATH Transmembrane 9 superfamily member 3 OS=Arabidopsis thaliana GN=TMN3 PE=2 SV=1 9 639 2.0E-107
sp|Q9FHT4|TMN4_ARATH Transmembrane 9 superfamily member 4 OS=Arabidopsis thaliana GN=TMN4 PE=2 SV=1 19 639 5.0E-105
sp|Q940S0|TMN2_ARATH Transmembrane 9 superfamily member 2 OS=Arabidopsis thaliana GN=TMN2 PE=2 SV=1 7 639 4.0E-103
sp|Q940G0|TMN1_ARATH Transmembrane 9 superfamily member 1 OS=Arabidopsis thaliana GN=TMN1 PE=1 SV=1 27 639 2.0E-88
sp|Q9DBU0|TM9S1_MOUSE Transmembrane 9 superfamily member 1 OS=Mus musculus GN=Tm9sf1 PE=2 SV=2 26 639 3.0E-87
sp|Q5R8F1|TM9S1_PONAB Transmembrane 9 superfamily member 1 OS=Pongo abelii GN=TM9SF1 PE=2 SV=1 21 639 4.0E-87
sp|A4IFE9|TM9S1_BOVIN Transmembrane 9 superfamily member 1 OS=Bos taurus GN=TM9SF1 PE=2 SV=1 21 639 2.0E-86
sp|O15321|TM9S1_HUMAN Transmembrane 9 superfamily member 1 OS=Homo sapiens GN=TM9SF1 PE=2 SV=2 21 639 4.0E-86
sp|Q9HD45|TM9S3_HUMAN Transmembrane 9 superfamily member 3 OS=Homo sapiens GN=TM9SF3 PE=1 SV=2 27 639 5.0E-86
sp|Q54ZW0|PHG1B_DICDI Putative phagocytic receptor 1b OS=Dictyostelium discoideum GN=phg1b PE=2 SV=1 28 639 5.0E-86
sp|Q9ET30|TM9S3_MOUSE Transmembrane 9 superfamily member 3 OS=Mus musculus GN=Tm9sf3 PE=1 SV=1 27 639 5.0E-86
sp|Q66HF2|TM9S1_RAT Transmembrane 9 superfamily member 1 OS=Rattus norvegicus GN=Tm9sf1 PE=2 SV=1 26 639 1.0E-79
sp|F4HW17|TMN5_ARATH Transmembrane 9 superfamily member 5 OS=Arabidopsis thaliana GN=TMN5 PE=2 SV=1 24 639 1.0E-75
sp|P40071|TMN3_YEAST Transmembrane 9 superfamily member 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TMN3 PE=1 SV=1 10 633 7.0E-52
sp|Q7YTA6|PHG1C_DICDI Putative phagocytic receptor 1c OS=Dictyostelium discoideum GN=phg1c PE=2 SV=1 177 639 8.0E-47
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 265 287 22
2 341 363 22
3 373 395 22
4 408 427 19
5 442 464 22
6 501 523 22
7 527 559 32
8 566 588 22
9 598 629 31

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1287
MHLRTALAAALAASASAFYLPGVAPTSYKPGDRVPLQVNSIRPVAAPQDNRLHSVVSYDYYHPDFHFCEPSGGPQ
YVPESLGSILSGDRLMTSPFELLMAKNETCKPLCKASYPVDSKRFVNERIEEAYSLNWLVDGLPAGQQIKDDLTG
TTFYSPGFQLGGYFLSSDEDEELSFNNHYEIWIEYHPVSGRENELRVVGAVVQPSSKLYTGEVDCADGHAPVSLT
SGDEEQQVQFSYSVYWRKSDTAWATRWDKYLHVFDPKIHWFWLIDTAVIVVILVLTVMSVLVRTLKKDIARYNRL
DQISLDDLSGTSVVEDGVQEDSGWKLIHGDVFRTPPRPLLLSVLLGNGAQLFVMTGLTIIFALLGFLSPSNRGSL
GTIMIILYTLLGSVGGYTSARTYKAMSGEQWKLNIALTPLLVPGIVFAAFFLLDLFLWAKRSSGAVPFTTMLVII
IIWFVISIPLSVVGSWMGFRSPQIEAPVRTNQIPRQIPPATTYLQPIPSMLIVGLLPFGAIFVELYFIMSSIWFS
RIYYMFGFLFLCYGLMIVVCAAVTVLMTYFLLCAENYNWQWRSFLAAGMSGGYIFLNCLLYLLTKVKLGGLAGIV
LYVGYSALISFLFFILAGSIGYFASWWFVRKIYSSIKID*
Coding >Ophun1|1287
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTTCCGGGAGTAGCGCCA
ACATCCTACAAACCCGGCGACCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCTCAAGATAAC
CGCCTACACTCGGTCGTCTCATACGACTATTACCATCCGGACTTTCACTTCTGCGAACCGTCCGGCGGCCCGCAG
TATGTGCCCGAGAGTCTGGGGAGCATTCTCTCGGGTGACAGGCTGATGACGTCGCCTTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCTGTCGACAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCATATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGCCAGCAAATCAAAGACGACTTGACGGGC
ACCACCTTTTATAGCCCTGGCTTTCAGCTCGGCGGCTACTTCCTCTCGTCTGACGAGGATGAGGAACTCTCCTTC
AATAACCATTACGAGATATGGATCGAATACCATCCGGTCAGTGGCAGAGAGAACGAGCTTCGCGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTGTACACGGGAGAGGTCGATTGCGCCGATGGCCACGCGCCAGTCTCTCTCACT
TCTGGCGATGAGGAGCAGCAGGTGCAATTTAGCTACAGCGTCTACTGGCGCAAGTCGGACACGGCCTGGGCCACG
CGCTGGGACAAGTACCTACACGTCTTCGACCCCAAGATTCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCGGTGCTCGTCAGGACACTGAAAAAGGACATTGCACGATACAACCGTCTG
GATCAGATCAGCCTCGATGACCTAAGTGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGCACGCCGCCTCGCCCCTTGCTGCTGTCTGTGCTACTTGGCAACGGCGCTCAA
CTGTTCGTCATGACTGGCTTGACCATTATCTTTGCTCTCCTCGGCTTTCTGTCACCTTCGAACCGCGGATCCCTG
GGCACCATCATGATCATTCTTTACACGCTTCTCGGTTCCGTCGGGGGTTACACGTCAGCCAGGACCTACAAGGCC
ATGTCCGGCGAACAATGGAAGCTCAACATCGCCTTGACGCCGCTTCTGGTTCCTGGCATTGTCTTCGCTGCCTTC
TTCCTCCTCGACCTCTTCTTGTGGGCCAAGCGGTCGTCCGGTGCGGTGCCCTTCACAACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCGTTGTCGGATCGTGGATGGGCTTCCGTAGCCCGCAGATCGAG
GCGCCGGTGCGCACGAATCAGATCCCTCGTCAGATTCCGCCGGCAACCACATATCTCCAGCCGATTCCCAGCATG
CTCATCGTCGGCCTTCTGCCCTTTGGCGCCATCTTCGTCGAGCTTTACTTCATCATGAGCTCCATCTGGTTCAGT
CGTATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGTCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACTTACTTCCTCCTCTGCGCCGAGAATTACAATTGGCAGTGGAGGTCGTTCCTAGCCGCTGGCATGAGC
GGCGGCTACATCTTCCTCAACTGCCTTCTCTATCTTCTCACAAAGGTGAAGCTCGGCGGGCTCGCTGGCATTGTC
CTTTACGTCGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTTCTATCGGCTACTTTGCGAGC
TGGTGGTTCGTTAGGAAGATTTACTCCTCTATCAAGATTGATTAG
Transcript >Ophun1|1287
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTTCCGGGAGTAGCGCCA
ACATCCTACAAACCCGGCGACCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCTCAAGATAAC
CGCCTACACTCGGTCGTCTCATACGACTATTACCATCCGGACTTTCACTTCTGCGAACCGTCCGGCGGCCCGCAG
TATGTGCCCGAGAGTCTGGGGAGCATTCTCTCGGGTGACAGGCTGATGACGTCGCCTTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCTGTCGACAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCATATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGCCAGCAAATCAAAGACGACTTGACGGGC
ACCACCTTTTATAGCCCTGGCTTTCAGCTCGGCGGCTACTTCCTCTCGTCTGACGAGGATGAGGAACTCTCCTTC
AATAACCATTACGAGATATGGATCGAATACCATCCGGTCAGTGGCAGAGAGAACGAGCTTCGCGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTGTACACGGGAGAGGTCGATTGCGCCGATGGCCACGCGCCAGTCTCTCTCACT
TCTGGCGATGAGGAGCAGCAGGTGCAATTTAGCTACAGCGTCTACTGGCGCAAGTCGGACACGGCCTGGGCCACG
CGCTGGGACAAGTACCTACACGTCTTCGACCCCAAGATTCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCGGTGCTCGTCAGGACACTGAAAAAGGACATTGCACGATACAACCGTCTG
GATCAGATCAGCCTCGATGACCTAAGTGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGCACGCCGCCTCGCCCCTTGCTGCTGTCTGTGCTACTTGGCAACGGCGCTCAA
CTGTTCGTCATGACTGGCTTGACCATTATCTTTGCTCTCCTCGGCTTTCTGTCACCTTCGAACCGCGGATCCCTG
GGCACCATCATGATCATTCTTTACACGCTTCTCGGTTCCGTCGGGGGTTACACGTCAGCCAGGACCTACAAGGCC
ATGTCCGGCGAACAATGGAAGCTCAACATCGCCTTGACGCCGCTTCTGGTTCCTGGCATTGTCTTCGCTGCCTTC
TTCCTCCTCGACCTCTTCTTGTGGGCCAAGCGGTCGTCCGGTGCGGTGCCCTTCACAACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCGTTGTCGGATCGTGGATGGGCTTCCGTAGCCCGCAGATCGAG
GCGCCGGTGCGCACGAATCAGATCCCTCGTCAGATTCCGCCGGCAACCACATATCTCCAGCCGATTCCCAGCATG
CTCATCGTCGGCCTTCTGCCCTTTGGCGCCATCTTCGTCGAGCTTTACTTCATCATGAGCTCCATCTGGTTCAGT
CGTATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGTCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACTTACTTCCTCCTCTGCGCCGAGAATTACAATTGGCAGTGGAGGTCGTTCCTAGCCGCTGGCATGAGC
GGCGGCTACATCTTCCTCAACTGCCTTCTCTATCTTCTCACAAAGGTGAAGCTCGGCGGGCTCGCTGGCATTGTC
CTTTACGTCGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTTCTATCGGCTACTTTGCGAGC
TGGTGGTTCGTTAGGAAGATTTACTCCTCTATCAAGATTGATTAG
Gene >Ophun1|1287
ATGCACCTCCGAACCGCCCTCGCGGCGGCGCTGGCGGCTTCGGCATCTGCCTTTTATCTTCCGGGAGTAGCGCCA
ACATCCTACAAACCCGGCGACCGCGTTCCCCTCCAGGTCAACAGCATCCGGCCCGTCGCCGCGCCTCAAGATAAC
CGCCTACACTCGGTCGTCTCATACGACTATTACCATCCGGACTTTCACTTCTGCGAACCGTCCGGCGGCCCGCAG
TATGTGCCCGAGAGTCTGGGGAGCATTCTCTCGGGTGACAGGCTGATGACGTCGCCTTTTGAGCTGCTCATGGCC
AAGAACGAAACCTGCAAGCCTCTATGCAAAGCATCCTACCCTGTCGACAGCAAGAGGTTCGTCAACGAGCGGATA
GAGGAGGCATATAGTCTCAACTGGCTCGTCGACGGCCTGCCTGCTGGCCAGCAAATCAAAGACGACTTGACGGGC
ACCACCTTTTATAGCCCTGGCTTTCAGCTCGGCGGCTACTTCCTCTCGTCTGACGAGGATGAGGAACTCTCCTTC
AATAACCATTACGAGATATGGATCGAATACCATCCGGTCAGTGGCAGAGAGAACGAGCTTCGCGTTGTCGGCGCC
GTCGTCCAGCCCAGCTCCAAGTTGTACACGGGAGAGGTCGATTGCGCCGATGGCCACGCGCCAGTCTCTCTCACT
TCTGGCGATGAGGAGCAGCAGGTGCAATTTAGCTACAGCGTCTACTGGCGCAAGTCGGACACGGCCTGGGCCACG
CGCTGGGACAAGTACCTACACGTCTTCGACCCCAAGATTCACTGGTTCTGGCTCATTGACACGGCCGTCATTGTC
GTCATACTCGTCCTGACCGTCATGTCGGTGCTCGTCAGGACACTGAAAAAGGACATTGCACGATACAACCGTCTG
GATCAGATCAGCCTCGATGACCTAAGTGGCACTTCGGTCGTCGAGGACGGTGTCCAAGAGGACTCGGGCTGGAAG
CTGATTCACGGCGACGTCTTTCGCACGCCGCCTCGCCCCTTGCTGCTGTCTGTGCTACTTGGCAACGGCGCTCAA
CTGTTCGTCATGACTGGCTTGACCATTATCTTTGCTCTCCTCGGCTTTCTGTCACCTTCGAACCGCGGATCCCTG
GGCACCATCATGATCATTCTTTACACGCTTCTCGGTTCCGTCGGGGGTTACACGTCAGCCAGGACCTACAAGGCC
ATGTCCGGCGAACAATGGAAGCTCAACATCGCCTTGACGCCGCTTCTGGTTCCTGGCATTGTCTTCGCTGCCTTC
TTCCTCCTCGACCTCTTCTTGTGGGCCAAGCGGTCGTCCGGTGCGGTGCCCTTCACAACGATGCTCGTCATCATC
ATCATCTGGTTTGTCATATCCATACCGCTGTCCGTTGTCGGATCGTGGATGGGCTTCCGTAGCCCGCAGATCGAG
GCGCCGGTGCGCACGAATCAGATCCCTCGTCAGATTCCGCCGGCAACCACATATCTCCAGCCGATTCCCAGCATG
CTCATCGTCGGCCTTCTGCCCTTTGGCGCCATCTTCGTCGAGCTTTACTTCATCATGAGCTCCATCTGGTTCAGT
CGTATCTATTACATGTTTGGGTTCCTCTTTCTCTGCTACGGTCTGATGATTGTCGTCTGCGCCGCCGTCACCGTC
CTCATGACTTACTTCCTCCTCTGCGCCGAGAATTACAATTGGCAGTGGAGGTCGTTCCTAGCCGCTGGCATGAGC
GGCGGCTACATCTTCCTCAACTGCCTTCTCTATCTTCTCACAAAGGTGAAGCTCGGCGGGCTCGCTGGCATTGTC
CTTTACGTCGGCTACAGCGCGCTCATCTCCTTTTTGTTCTTCATTCTTGCCGGTACGCTTTCCTCCCAACAGTTT
CTCCAGCCGCTTGTTCTTAACGCACCCACAGGTTCTATCGGCTACTTTGCGAGCTGGTGGTTCGTTAGGAAGATT
TACTCCTCTATCAAGATTGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail