Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1284
Gene name
LocationContig_150:2073..12939
Strand+
Gene length (bp)10866
Transcript length (bp)10779
Coding sequence length (bp)10779
Protein length (aa) 3593

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.2E-58 59 459
PF00501 AMP-binding AMP-binding enzyme 2.0E-71 1188 1581
PF00501 AMP-binding AMP-binding enzyme 5.4E-69 2980 3382
PF00668 Condensation Condensation domain 2.6E-35 736 1144
PF00668 Condensation Condensation domain 5.4E-20 1814 1988
PF00668 Condensation Condensation domain 7.7E-34 2291 2703
PF00550 PP-binding Phosphopantetheine attachment site 4.9E-05 606 669
PF00550 PP-binding Phosphopantetheine attachment site 5.3E-08 1724 1787
PF00550 PP-binding Phosphopantetheine attachment site 1.8E-13 3522 3583

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6 2708 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 944 2702 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 39 2703 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 32 2617 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 49 2788 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 6 2708 0.0E+00
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 944 2702 0.0E+00
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 39 2703 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 32 2617 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 49 2788 0.0E+00
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 39 1875 0.0E+00
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 50 1872 0.0E+00
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 50 1872 0.0E+00
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 50 1786 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 52 1867 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 33 1875 0.0E+00
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1131 2687 0.0E+00
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 52 2614 7.0E-173
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 35 1202 6.0E-170
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 2614 3.0E-159
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 50 2582 2.0E-156
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 53 2614 1.0E-155
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 42 2614 5.0E-150
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 52 2614 9.0E-148
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 45 2235 2.0E-146
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 50 2246 6.0E-144
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 733 1870 4.0E-137
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 45 2168 1.0E-136
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2709 3574 2.0E-135
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1164 1867 2.0E-135
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 49 2223 9.0E-133
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 50 2223 3.0E-132
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 64 1808 6.0E-129
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 734 1892 2.0E-128
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 49 2138 8.0E-128
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 46 2243 9.0E-128
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2923 3583 1.0E-127
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 52 2228 1.0E-127
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2715 3587 2.0E-126
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1746 2675 7.0E-126
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2715 3587 1.0E-125
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 48 2221 1.0E-123
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2712 3587 1.0E-122
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 825 2701 2.0E-121
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2698 3582 3.0E-119
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 710 1795 6.0E-117
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 52 2233 4.0E-114
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 732 2582 2.0E-113
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 707 1973 1.0E-110
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2658 3582 2.0E-110
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 739 1953 9.0E-110
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2715 3583 2.0E-109
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 57 1840 2.0E-109
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 42 1973 4.0E-109
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 731 1986 2.0E-108
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1073 2582 3.0E-108
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 55 1969 4.0E-108
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 38 1040 6.0E-108
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 731 1882 2.0E-107
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2718 3581 5.0E-107
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 50 1967 9.0E-107
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2705 3582 5.0E-106
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 44 1973 7.0E-106
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 37 2134 4.0E-105
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 44 1973 5.0E-105
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1106 2614 2.0E-104
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 77 1967 1.0E-103
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2903 3584 5.0E-103
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2708 3591 6.0E-103
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 684 1953 2.0E-102
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2918 3582 1.0E-100
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 39 1868 3.0E-100
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1119 1787 3.0E-100
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 65 1964 3.0E-100
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 21 1964 1.0E-99
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1176 1797 3.0E-99
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2975 3575 4.0E-99
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2898 3582 7.0E-98
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 53 1960 1.0E-97
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 49 1967 2.0E-97
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 53 1960 2.0E-97
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 52 1963 4.0E-97
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 28 1808 5.0E-97
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1171 2276 5.0E-97
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2975 3575 9.0E-97
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2975 3575 9.0E-97
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2969 3582 1.0E-95
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 28 1808 9.0E-95
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2896 3582 1.0E-94
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2719 3591 2.0E-94
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2911 3582 3.0E-94
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 1130 1786 3.0E-94
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 52 1973 4.0E-94
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 23 2028 5.0E-94
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 53 1998 5.0E-94
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 701 1868 7.0E-93
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 50 1819 2.0E-92
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 40 1060 3.0E-92
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2775 3583 5.0E-92
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 734 1868 5.0E-92
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 17 1038 9.0E-92
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2780 3583 3.0E-91
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 52 1973 8.0E-91
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 52 1964 3.0E-90
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 75 1968 9.0E-90
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1115 1892 1.0E-89
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 734 1986 1.0E-89
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 23 2130 1.0E-89
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 732 1960 2.0E-88
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1182 2233 5.0E-88
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1182 2233 2.0E-87
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 734 1987 5.0E-87
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 734 1987 1.0E-86
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1167 2222 3.0E-86
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2923 3574 6.0E-85
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 78 1787 7.0E-85
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2653 3589 2.0E-84
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 732 1967 4.0E-84
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 618 1790 5.0E-84
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 737 1785 6.0E-84
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 734 1987 7.0E-84
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 726 1991 1.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2590 3576 3.0E-83
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 18 1056 4.0E-83
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 733 1986 3.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 734 1695 1.0E-81
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2937 3583 5.0E-81
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 733 1986 1.0E-80
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 733 1868 4.0E-80
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 733 1972 6.0E-80
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2774 3582 6.0E-78
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 50 1037 3.0E-77
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 734 1960 9.0E-76
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 733 1974 1.0E-75
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 45 1868 5.0E-75
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 733 1800 9.0E-74
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 72 1868 2.0E-73
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 734 1781 2.0E-72
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 737 1808 5.0E-72
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2971 3582 2.0E-71
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2780 3576 4.0E-71
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2780 3589 4.0E-71
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 53 1786 9.0E-71
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2911 3582 6.0E-69
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2713 3582 2.0E-68
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 32 669 3.0E-68
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 737 1904 1.0E-67
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2975 3583 3.0E-67
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 39 667 5.0E-67
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2715 3582 5.0E-67
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2715 3582 7.0E-67
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 758 1786 2.0E-66
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2910 3582 4.0E-66
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2780 3581 7.0E-66
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2705 3512 8.0E-66
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 825 1992 8.0E-66
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 843 2167 8.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2715 3578 1.0E-65
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 739 1986 1.0E-65
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 32 667 3.0E-65
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2913 3582 3.0E-65
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 600 1969 3.0E-65
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 32 667 4.0E-65
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2715 3582 7.0E-65
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2715 3582 3.0E-64
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2887 3584 5.0E-64
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1665 2627 5.0E-64
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2783 3583 6.0E-64
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2775 3558 1.0E-63
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2771 3584 3.0E-63
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2775 3582 3.0E-63
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 822 1960 4.0E-63
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2775 3558 5.0E-63
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2901 3581 6.0E-63
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2953 3582 6.0E-63
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2978 3582 1.0E-62
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1183 1785 1.0E-62
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2775 3582 2.0E-62
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2781 3592 2.0E-62
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2775 3582 3.0E-62
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 77 1144 4.0E-62
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2732 3582 4.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2780 3582 5.0E-62
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2910 3582 5.0E-62
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2877 3587 6.0E-62
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2758 3583 9.0E-62
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2913 3582 1.0E-61
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2877 3587 1.0E-61
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2715 3582 2.0E-61
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2971 3581 4.0E-61
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2774 3582 4.0E-61
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2930 3583 4.0E-61
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2732 3592 5.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2775 3582 6.0E-61
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2715 3582 1.0E-60
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2760 3584 2.0E-60
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2620 3564 2.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2946 3582 4.0E-60
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1194 2177 5.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2975 3581 7.0E-60
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 846 2198 1.0E-59
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 846 2198 1.0E-59
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2975 3581 1.0E-59
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2779 3582 3.0E-59
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2775 3582 3.0E-59
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 50 692 5.0E-59
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2896 3583 8.0E-59
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2977 3583 1.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2780 3584 2.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2728 3582 2.0E-58
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2896 3583 4.0E-58
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1147 2017 6.0E-58
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2978 3583 8.0E-58
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2866 3582 1.0E-57
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2909 3581 1.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2911 3581 1.0E-57
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2700 3582 1.0E-57
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2775 3582 1.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 828 1953 1.0E-57
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2931 3581 2.0E-57
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2773 3582 2.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2896 3583 2.0E-57
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2972 3582 4.0E-57
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2768 3578 7.0E-57
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2898 3582 1.0E-56
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2814 3586 1.0E-56
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2905 3582 2.0E-56
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2909 3583 3.0E-56
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2715 3583 3.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2783 3582 4.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2779 3584 4.0E-56
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2975 3582 5.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2960 3589 6.0E-56
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2715 3582 1.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2975 3583 4.0E-55
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1173 1785 4.0E-55
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2913 3592 5.0E-55
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2783 3581 5.0E-55
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 31 650 5.0E-55
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 204 1786 8.0E-55
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2816 3582 2.0E-54
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 736 1591 2.0E-54
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2775 3589 3.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2870 3591 4.0E-54
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1183 1789 2.0E-53
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2948 3589 4.0E-53
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1820 2237 6.0E-53
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2948 3589 7.0E-53
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2775 3582 9.0E-53
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2753 3582 1.0E-52
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1083 1964 1.0E-52
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2908 3582 1.0E-52
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2960 3582 1.0E-52
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2775 3582 5.0E-52
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2973 3584 5.0E-52
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 51 1002 9.0E-52
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 816 1786 5.0E-51
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2290 2702 7.0E-51
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2780 3582 7.0E-51
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1170 1799 4.0E-50
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2896 3584 6.0E-50
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2287 2703 7.0E-50
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1094 1980 3.0E-49
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 18 719 6.0E-49
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1094 1970 6.0E-49
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1111 1953 8.0E-48
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2732 3556 8.0E-48
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 54 1043 1.0E-47
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 38 580 7.0E-47
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2713 3582 7.0E-47
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2909 3429 1.0E-46
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 353 1062 2.0E-46
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2910 3583 9.0E-46
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2779 3578 1.0E-45
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2886 3592 1.0E-45
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 1182 1789 2.0E-45
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 76 1187 2.0E-45
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1062 1854 7.0E-45
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 53 641 2.0E-44
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2973 3583 3.0E-44
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2930 3581 5.0E-44
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 54 1049 2.0E-43
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 35 667 3.0E-43
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 22 694 3.0E-43
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 41 672 2.0E-42
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 1128 1953 2.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1207 1790 2.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1182 1789 2.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1182 1789 2.0E-42
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2975 3592 3.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2997 3582 8.0E-42
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2964 3562 1.0E-41
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2979 3581 3.0E-41
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2996 3582 3.0E-41
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1186 1693 4.0E-41
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2964 3562 5.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1184 1693 7.0E-41
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1186 1693 7.0E-41
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1186 1693 7.0E-41
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1186 1693 7.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2964 3562 8.0E-41
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1186 1693 9.0E-41
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2974 3495 1.0E-40
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1186 1693 1.0E-40
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1186 1693 1.0E-40
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1186 1693 1.0E-40
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1186 1693 1.0E-40
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2908 3587 2.0E-40
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2908 3587 2.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1186 1693 2.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1186 1693 2.0E-40
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 853 1645 3.0E-40
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3000 3589 3.0E-40
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1186 1693 3.0E-40
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2974 3495 6.0E-40
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2974 3495 6.0E-40
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2974 3495 6.0E-40
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2975 3562 6.0E-40
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2909 3583 7.0E-40
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2975 3562 7.0E-40
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2975 3562 7.0E-40
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1186 1693 7.0E-40
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 52 671 1.0E-39
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2974 3495 1.0E-39
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2897 3582 1.0E-39
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1186 1693 2.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 1171 1786 2.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 1171 1786 2.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 1171 1786 2.0E-39
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2974 3495 2.0E-39
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1186 1693 2.0E-39
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2974 3495 3.0E-39
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2774 3582 4.0E-39
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1138 1785 4.0E-39
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 1181 1810 4.0E-39
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2887 3583 4.0E-39
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1109 1693 7.0E-39
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1201 1953 9.0E-39
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1138 1785 9.0E-39
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 50 693 2.0E-38
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1138 1785 2.0E-38
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 48 670 3.0E-38
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2974 3495 3.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2994 3592 5.0E-38
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 42 679 6.0E-38
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2974 3495 7.0E-38
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2998 3582 1.0E-37
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 77 1038 1.0E-37
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2895 3582 2.0E-37
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1181 1814 2.0E-37
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 42 667 5.0E-37
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 35 647 6.0E-37
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1181 1693 6.0E-37
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2984 3581 1.0E-36
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1182 1813 1.0E-36
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2974 3490 1.0E-36
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1181 1785 1.0E-36
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 37 641 2.0E-36
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 57 669 3.0E-36
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1181 1791 3.0E-36
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 35 647 4.0E-36
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2974 3489 5.0E-36
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 35 647 7.0E-36
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 57 1056 7.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1181 1788 7.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2975 3573 8.0E-36
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 53 674 1.0E-35
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 53 674 1.0E-35
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1194 1817 1.0E-35
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3262 3582 2.0E-35
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2975 3582 2.0E-35
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2911 3489 2.0E-35
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2996 3583 2.0E-35
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 19 668 3.0E-35
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2975 3582 3.0E-35
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 41 674 4.0E-35
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 27 669 1.0E-34
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1206 1959 1.0E-34
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1184 1691 1.0E-34
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 38 688 2.0E-34
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 31 677 2.0E-34
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 1181 1790 2.0E-34
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 27 669 4.0E-34
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2975 3583 7.0E-34
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 40 1047 1.0E-33
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 17 668 1.0E-33
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1181 1693 1.0E-33
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2992 3489 1.0E-33
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1181 1693 1.0E-33
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 50 670 4.0E-33
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2979 3491 6.0E-33
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1184 1694 7.0E-33
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 36 673 1.0E-32
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 56 667 1.0E-32
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2992 3491 1.0E-32
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 17 669 3.0E-32
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 40 643 4.0E-32
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2998 3569 4.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2979 3489 6.0E-32
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2992 3491 8.0E-32
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 50 674 9.0E-32
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1186 1691 1.0E-31
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2999 3489 3.0E-31
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2992 3491 5.0E-31
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 38 1037 6.0E-31
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2979 3491 1.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2992 3491 1.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2992 3491 1.0E-30
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 52 869 2.0E-30
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 54 674 3.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1184 1691 4.0E-30
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2979 3491 5.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1180 1695 7.0E-30
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1184 1691 8.0E-30
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2967 3581 2.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1184 1689 2.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1184 1689 2.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1184 1689 2.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1184 1689 2.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2979 3489 2.0E-29
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1184 1689 2.0E-29
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 77 1059 3.0E-29
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1180 1691 3.0E-29
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1248 1606 3.0E-29
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2975 3489 5.0E-29
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2975 3489 5.0E-29
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2975 3489 5.0E-29
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 50 667 6.0E-29
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1190 1693 1.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2979 3489 1.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2964 3489 1.0E-28
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1184 1689 1.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2964 3489 1.0E-28
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1184 1689 1.0E-28
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 56 674 2.0E-28
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1110 1661 2.0E-28
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1190 1691 2.0E-28
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1190 1691 2.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2977 3489 2.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2977 3489 2.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2977 3489 2.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2973 3584 3.0E-28
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2964 3489 3.0E-28
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2964 3489 3.0E-28
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2964 3489 3.0E-28
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2964 3489 3.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2977 3489 3.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2977 3489 3.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2977 3489 3.0E-28
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1190 1691 3.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2977 3489 4.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2977 3489 4.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2977 3489 4.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2977 3489 4.0E-28
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1492 1990 5.0E-28
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 56 732 5.0E-28
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1186 1693 5.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2977 3489 6.0E-28
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1186 1691 6.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2979 3489 7.0E-28
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2896 3441 1.0E-27
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 47 667 1.0E-27
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2964 3489 1.0E-27
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 47 667 2.0E-27
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1180 1695 2.0E-27
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1180 1695 2.0E-27
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1184 1693 3.0E-27
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1184 1693 3.0E-27
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1184 1693 3.0E-27
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1184 1693 3.0E-27
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1180 1695 4.0E-27
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1184 1693 4.0E-27
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1184 1693 5.0E-27
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1184 1693 5.0E-27
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1205 1761 6.0E-27
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2977 3492 7.0E-27
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1184 1693 7.0E-27
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1184 1693 7.0E-27
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1184 1693 7.0E-27
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1180 1693 9.0E-27
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1186 1693 9.0E-27
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 65 578 1.0E-26
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 47 482 2.0E-26
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2977 3492 3.0E-26
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 53 672 1.0E-25
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 3000 3583 1.0E-25
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2983 3492 1.0E-25
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1204 1689 2.0E-25
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2983 3492 2.0E-25
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 52 647 3.0E-25
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1204 1689 3.0E-25
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1204 1689 3.0E-25
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1180 1695 5.0E-25
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 839 1827 7.0E-25
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2983 3492 2.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2983 3492 2.0E-24
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 47 664 4.0E-24
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 52 642 5.0E-24
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 52 642 5.0E-24
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 52 642 5.0E-24
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2970 3489 5.0E-24
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 591 1038 1.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2963 3573 1.0E-23
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 51 668 3.0E-23
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 35 657 5.0E-23
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 50 667 2.0E-22
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 31 715 2.0E-22
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1204 1689 2.0E-22
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 51 667 3.0E-22
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 35 657 4.0E-22
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 58 576 1.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 733 1056 2.0E-21
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3042 3430 3.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 509 1036 4.0E-21
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2948 3429 5.0E-21
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 51 668 6.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 722 1057 2.0E-20
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 59 578 2.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1231 1759 2.0E-20
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 51 668 5.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 3025 3574 7.0E-20
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 45 667 1.0E-19
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2975 3489 1.0E-19
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1206 1691 1.0E-19
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 58 580 2.0E-19
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 69 669 3.0E-19
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 56 580 1.0E-18
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 58 580 2.0E-18
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 58 580 2.0E-18
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 58 580 2.0E-18
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 58 580 2.0E-18
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1328 1770 2.0E-18
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 58 580 3.0E-18
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 58 580 3.0E-18
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 58 580 3.0E-18
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 58 580 3.0E-18
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 58 580 4.0E-18
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 58 580 6.0E-18
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 58 580 6.0E-18
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 51 641 8.0E-18
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 51 641 8.0E-18
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3457 3582 9.0E-18
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 2994 3392 9.0E-18
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 58 579 1.0E-17
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 58 580 2.0E-17
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 58 580 2.0E-17
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 59 578 3.0E-17
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 59 578 3.0E-17
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 55 580 3.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2289 2704 5.0E-17
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 58 580 5.0E-17
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 76 593 5.0E-17
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1182 1759 6.0E-17
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 55 580 7.0E-17
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1326 1762 9.0E-17
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 3124 3557 5.0E-16
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 35 667 6.0E-16
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 55 580 7.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2290 2698 8.0E-16
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2288 2637 9.0E-16
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 60 578 9.0E-16
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 52 589 1.0E-15
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 35 653 1.0E-15
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 78 580 1.0E-15
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 65 576 2.0E-15
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 78 580 2.0E-15
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 78 580 2.0E-15
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 78 580 2.0E-15
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 42 574 2.0E-15
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 42 574 2.0E-15
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 49 578 2.0E-15
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 49 578 2.0E-15
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 49 578 2.0E-15
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 49 578 2.0E-15
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2999 3490 2.0E-15
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 729 1056 3.0E-15
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 78 578 3.0E-15
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2288 2702 4.0E-15
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 55 576 4.0E-15
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 49 578 4.0E-15
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 49 578 5.0E-15
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 49 578 5.0E-15
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 49 578 5.0E-15
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 49 578 5.0E-15
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 49 578 5.0E-15
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2975 3499 7.0E-15
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2975 3491 7.0E-15
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2288 2624 1.0E-14
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 55 578 1.0E-14
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 55 576 1.0E-14
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 42 574 1.0E-14
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 42 574 1.0E-14
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 42 574 1.0E-14
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 42 574 1.0E-14
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2975 3491 1.0E-14
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1211 1696 2.0E-14
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1165 1652 2.0E-14
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2975 3396 2.0E-14
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1238 1652 2.0E-14
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 1198 1724 2.0E-14
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2290 2578 3.0E-14
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 13 641 3.0E-14
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2340 2632 4.0E-14
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 78 578 4.0E-14
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 1198 1699 4.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1281 1693 6.0E-14
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2998 3491 6.0E-14
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 1322 1695 6.0E-14
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 1322 1695 6.0E-14
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2294 2690 7.0E-14
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2284 2614 8.0E-14
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2296 2634 9.0E-14
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 1322 1695 9.0E-14
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 1322 1695 9.0E-14
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 1322 1695 9.0E-14
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 42 574 1.0E-13
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 3124 3557 1.0E-13
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2985 3495 1.0E-13
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 1322 1695 1.0E-13
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 2979 3492 1.0E-13
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2998 3490 1.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 1178 1645 1.0E-13
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1229 1695 1.0E-13
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 1329 1695 1.0E-13
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 1329 1695 1.0E-13
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 1322 1696 2.0E-13
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 3018 3392 3.0E-13
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 1205 1652 3.0E-13
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 1410 1652 3.0E-13
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 2999 3490 4.0E-13
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 1198 1723 4.0E-13
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 1198 1723 4.0E-13
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 3000 3490 6.0E-13
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 1179 1699 6.0E-13
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2286 2614 7.0E-13
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1327 1695 7.0E-13
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2294 2632 9.0E-13
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 198 576 9.0E-13
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1164 1694 9.0E-13
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 1322 1710 9.0E-13
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 1322 1695 9.0E-13
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2290 2657 1.0E-12
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2284 2623 1.0E-12
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 1322 1695 1.0E-12
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 1322 1695 1.0E-12
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 3000 3490 1.0E-12
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 1207 1723 1.0E-12
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 3125 3397 2.0E-12
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 1322 1695 2.0E-12
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 1322 1696 2.0E-12
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2985 3392 2.0E-12
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 1322 1695 2.0E-12
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 1184 1694 2.0E-12
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 3000 3490 2.0E-12
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2281 2677 3.0E-12
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1179 1652 3.0E-12
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2992 3392 3.0E-12
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1179 1704 4.0E-12
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2285 2662 5.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 45 493 5.0E-12
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1256 1694 5.0E-12
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 1323 1695 5.0E-12
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2992 3491 5.0E-12
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2285 2638 6.0E-12
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2288 2614 6.0E-12
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 102 661 6.0E-12
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2997 3392 6.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2975 3487 6.0E-12
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 1321 1696 6.0E-12
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 3000 3490 6.0E-12
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2285 2662 7.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2288 2614 8.0E-12
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1186 1696 9.0E-12
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 3000 3490 9.0E-12
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1205 1652 1.0E-11
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2975 3491 1.0E-11
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 1179 1723 1.0E-11
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 3000 3490 1.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 2994 3491 1.0E-11
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 3000 3490 1.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2718 2995 2.0E-11
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 56 685 2.0E-11
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 3000 3490 2.0E-11
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 3000 3490 2.0E-11
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 3000 3490 2.0E-11
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 1207 1652 3.0E-11
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1229 1652 3.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 2962 3490 3.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 2962 3490 3.0E-11
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 3000 3490 3.0E-11
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 3000 3490 3.0E-11
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 1184 1700 3.0E-11
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2996 3490 3.0E-11
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2996 3490 3.0E-11
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 3000 3442 3.0E-11
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 1205 1694 4.0E-11
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 3000 3490 4.0E-11
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 1201 1652 4.0E-11
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1184 1694 4.0E-11
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2290 2638 5.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2288 2582 6.0E-11
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2975 3490 6.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1164 1629 6.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1164 1629 6.0E-11
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 3000 3490 6.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 1188 1696 6.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 3000 3490 7.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 3000 3490 7.0E-11
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2285 2714 8.0E-11
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 3000 3490 8.0E-11
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 3000 3490 9.0E-11
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 3000 3490 9.0E-11
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 3000 3490 9.0E-11
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 1184 1694 9.0E-11
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2338 2616 1.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 723 1092 1.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 1217 1652 1.0E-10
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 1327 1726 1.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 2975 3410 1.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 2975 3410 1.0E-10
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2981 3392 1.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2290 2662 2.0E-10
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1322 1696 2.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1200 1652 2.0E-10
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1329 1695 2.0E-10
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1327 1695 2.0E-10
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 1303 1694 2.0E-10
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 3125 3490 2.0E-10
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 3000 3490 2.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2248 2585 3.0E-10
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2274 2578 3.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1326 1696 3.0E-10
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2996 3490 3.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2286 2678 4.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2998 3392 4.0E-10
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 3000 3490 4.0E-10
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 3000 3490 4.0E-10
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2280 2625 5.0E-10
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2281 2620 5.0E-10
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2975 3491 6.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 3122 3492 7.0E-10
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 2942 3403 7.0E-10
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 1321 1721 7.0E-10
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 73 581 8.0E-10
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2992 3491 8.0E-10
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1179 1699 9.0E-10
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 61 530 9.0E-10
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 1206 1723 1.0E-09
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 3019 3392 1.0E-09
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2339 2711 2.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2283 2677 2.0E-09
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 197 580 2.0E-09
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 1180 1690 2.0E-09
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 1180 1690 2.0E-09
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 1272 1696 2.0E-09
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 2994 3491 2.0E-09
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 1320 1696 2.0E-09
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 1184 1694 2.0E-09
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2283 2677 3.0E-09
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 75 492 3.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2957 3490 3.0E-09
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 2998 3492 3.0E-09
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 1188 1591 3.0E-09
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 71 489 3.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2992 3491 3.0E-09
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 2999 3392 3.0E-09
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 1323 1655 3.0E-09
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 2994 3491 3.0E-09
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2280 2577 4.0E-09
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1206 1699 4.0E-09
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 101 449 4.0E-09
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2994 3490 4.0E-09
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 2942 3392 4.0E-09
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 1329 1689 4.0E-09
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1160 1694 5.0E-09
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 3121 3497 5.0E-09
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 3019 3397 5.0E-09
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 1327 1694 5.0E-09
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 1329 1694 5.0E-09
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1329 1696 5.0E-09
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1242 1591 6.0E-09
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 2942 3403 6.0E-09
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 1329 1694 6.0E-09
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2343 2663 7.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2286 2601 7.0E-09
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 3123 3500 7.0E-09
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2998 3492 7.0E-09
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 1322 1696 8.0E-09
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 1306 1645 9.0E-09
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 2977 3392 9.0E-09
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 2977 3392 9.0E-09
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2270 2677 1.0E-08
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2282 2677 1.0E-08
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2281 2665 1.0E-08
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 3443 3591 1.0E-08
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 71 491 1.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 3020 3396 1.0E-08
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2999 3499 1.0E-08
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 1198 1708 1.0E-08
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 2998 3491 1.0E-08
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1311 1694 1.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 1184 1694 1.0E-08
sp|Q9X928|ACSA_STRCO Acetyl-coenzyme A synthetase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=acsA PE=3 SV=1 1206 1721 1.0E-08
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 2999 3531 1.0E-08
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2999 3490 1.0E-08
sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=2 2984 3392 1.0E-08
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2294 2712 2.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2284 2677 2.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 69 588 2.0E-08
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 1306 1694 2.0E-08
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 1306 1694 2.0E-08
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 1171 1639 2.0E-08
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 3000 3490 2.0E-08
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 3113 3492 2.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1324 1651 2.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 1198 1708 2.0E-08
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1722 2176 2.0E-08
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1722 2176 2.0E-08
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 1318 1696 2.0E-08
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1722 2176 2.0E-08
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 1318 1696 2.0E-08
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 3000 3491 2.0E-08
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 770 1036 3.0E-08
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 3119 3392 3.0E-08
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 1329 1694 3.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 3120 3490 3.0E-08
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 1329 1694 3.0E-08
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 2998 3491 3.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2979 3392 3.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 3113 3492 3.0E-08
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2996 3492 4.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 1324 1694 4.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 1186 1693 4.0E-08
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 1070 1699 4.0E-08
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 2999 3392 4.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 821 1038 5.0E-08
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2290 2615 5.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 3000 3490 5.0E-08
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 3000 3392 5.0E-08
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1313 1694 5.0E-08
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1178 1694 6.0E-08
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2294 2664 7.0E-08
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 1306 1694 7.0E-08
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 1320 1651 7.0E-08
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 1306 1694 8.0E-08
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 1321 1696 8.0E-08
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 1321 1696 8.0E-08
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 77 579 8.0E-08
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 77 579 8.0E-08
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 77 579 8.0E-08
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2285 2605 9.0E-08
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 547 668 9.0E-08
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 76 286 9.0E-08
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 1306 1694 9.0E-08
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 1188 1687 9.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2292 2706 1.0E-07
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2283 2618 1.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2340 2678 1.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1661 1866 1.0E-07
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 76 641 1.0E-07
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 1306 1694 1.0E-07
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 339 579 1.0E-07
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 1306 1694 1.0E-07
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 1306 1694 1.0E-07
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 1306 1694 1.0E-07
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 1324 1694 1.0E-07
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 3116 3397 1.0E-07
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 77 579 1.0E-07
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 3116 3392 1.0E-07
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 1310 1696 1.0E-07
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 2985 3491 1.0E-07
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 1203 1696 1.0E-07
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 1203 1591 1.0E-07
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 2981 3492 1.0E-07
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 1327 1696 1.0E-07
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 18 280 2.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 3117 3501 2.0E-07
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 76 579 2.0E-07
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 3118 3392 2.0E-07
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 1306 1694 2.0E-07
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 1306 1694 2.0E-07
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 1207 1694 2.0E-07
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 1207 1694 2.0E-07
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 1207 1694 2.0E-07
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 1306 1694 2.0E-07
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 77 579 2.0E-07
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 1319 1696 2.0E-07
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 77 579 2.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 550 895 3.0E-07
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 76 492 3.0E-07
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1310 1694 3.0E-07
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 1306 1694 3.0E-07
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 61 581 3.0E-07
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 3121 3490 3.0E-07
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 65 578 3.0E-07
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2999 3490 3.0E-07
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 77 579 3.0E-07
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 77 579 3.0E-07
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 77 579 3.0E-07
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 1205 1720 3.0E-07
sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 2984 3392 3.0E-07
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 1239 1697 3.0E-07
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 1321 1696 3.0E-07
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 1319 1696 3.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2326 2677 4.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3447 3582 4.0E-07
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 1306 1657 4.0E-07
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 1306 1694 4.0E-07
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1319 1595 4.0E-07
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 1205 1669 4.0E-07
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 1205 1669 4.0E-07
sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 2984 3392 4.0E-07
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1326 1694 4.0E-07
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 1315 1694 5.0E-07
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 1174 1694 5.0E-07
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 77 579 5.0E-07
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1229 1696 5.0E-07
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1324 1694 5.0E-07
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1329 1694 5.0E-07
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 77 467 6.0E-07
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 339 579 6.0E-07
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 2976 3392 6.0E-07
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 77 579 6.0E-07
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1200 1652 7.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 3105 3504 7.0E-07
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3517 3581 8.0E-07
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 1207 1694 9.0E-07
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 1306 1694 9.0E-07
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 1306 1694 9.0E-07
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 3447 3582 1.0E-06
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 77 579 1.0E-06
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 1306 1694 1.0E-06
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 78 579 1.0E-06
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 3000 3490 1.0E-06
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 44 575 1.0E-06
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 44 575 1.0E-06
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 3121 3490 1.0E-06
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 1158 1698 1.0E-06
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 2999 3447 1.0E-06
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 77 579 1.0E-06
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 77 579 1.0E-06
sp|B8EPJ0|ACSA_METSB Acetyl-coenzyme A synthetase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=acsA PE=3 SV=1 2999 3447 1.0E-06
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 78 579 2.0E-06
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 65 584 2.0E-06
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 1188 1694 2.0E-06
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 339 579 2.0E-06
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 1329 1694 2.0E-06
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 1205 1669 2.0E-06
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 1205 1669 2.0E-06
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 1205 1669 2.0E-06
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 2998 3137 2.0E-06
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 1203 1696 2.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 3122 3492 2.0E-06
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 1329 1694 2.0E-06
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1329 1696 2.0E-06
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 78 579 3.0E-06
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 78 579 3.0E-06
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 1205 1669 3.0E-06
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 2965 3392 3.0E-06
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 1242 1652 3.0E-06
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 2999 3392 3.0E-06
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 1304 1694 3.0E-06
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 26 580 4.0E-06
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 78 579 4.0E-06
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 3121 3490 4.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1320 1652 5.0E-06
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 1306 1696 5.0E-06
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 3112 3492 5.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1651 1778 6.0E-06
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 1306 1694 6.0E-06
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 1306 1694 6.0E-06
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 1306 1694 6.0E-06
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 1205 1669 6.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 1309 1693 6.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 1309 1693 6.0E-06
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 76 581 6.0E-06
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 74 580 7.0E-06
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1320 1652 7.0E-06
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 1205 1669 7.0E-06
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 1322 1699 7.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2343 2619 9.0E-06
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 1184 1592 9.0E-06
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 1184 1592 9.0E-06
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2339 2637 1.0E-05
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 3119 3428 1.0E-05
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 3119 3493 1.0E-05
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1319 1699 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1284
MRYHVDPVCNGNGIPHVNGETTLKQAVKETLPRGLTDIWARNASIPETVEACVHSIFKKIACEQPSAPAVCSWDG
NLSYGELDALSSRLAHRLVRLGVGPGKTVLLSFDKSMMMPIAALAVMKAGGASVALDVTLPEDHLRVVASQAAAP
FILCSAANESLARNLISSGSDDQVVLVVVDPEQLSNPANKQQQHEQQQELPLVTPSDVLYIVFTSGSKGAMITHR
NFSSAIAYQQKALGFDGSSRVYDHASYASHVAWFNLLHALTCGGCLCIPSEPDRRSNIAASIAELGATYAQLPPS
VARSLSKFPSCLQRLNLVGEPASPLEAREHLNHHYQEHQEHHVATVSAYGQAETASLAAVWAATDASHPLPAGVC
AWIVDAEDPSSLAPFGAEGELWLEGPLVGPGYLKDPDGTAEAFIQDPEWLLQGCAPKWPGRRGRVHRTGDLVRYD
DAGQLVFVGHREQPRLRGGERIDASVVEHHLRRAAASVPDEDAYGLQLIAETIQPQGADDAVLVAFIALDGARDM
PEREYGEAAQRVAARVSECLSASPLPPHMVPEAFIPIQAVPLTATGKVDRQCLRSIGSLLTESEMARLRRDGAGQ
TEFERLIAELWAQTLQMQPSSFARDDDFFASGGDATAALRLCRLARERELPLEARQVFRSPRLRDMAAWAATQKP
WEPTPTNGMTSCLSETSSSSPLEPSSPSTPPFSLLARPVDEAEVRAHAARLCRVPDASVVDVMPCTPLQAGLLAL
TAQQDGAYVARNVLELGPDVDIGRFRASWEQVVALNPILRTRIVSLPRHGVVQVVLEEGVHWHSGSGDANDYVLD
KASRPMGLGTPLSRFALFERGRQLVWEVHHALYDGWSLPLLMQEAEHVYYDETSPPLEPMTNLIKYISERDETAT
KTFWQSQFAGIKGAHFPAPPRSGATSYEPHPDSQITRAVSDLKWGQADVTPASVIRAAWAIMVAHSADSDEALFG
LTVTGRQAAVPGIERMAGPAIATVPVRVVLNWDDSVSRLLGSVQKQAAEMIPYEQTGLQHIRRVSEAAAVACGFQ
SLLVIQPGGGGSGADDSSETANHRIFLKEPAADDENHVSEQSKDFDTYAVVVECQLDTDEVRLRIGFDSSVVGRR
QMDRIVRGFESVLRLLCAEQHAKDRLRAAIVPSLSQASIDDIWRWNATVPAAVHTCIHDLVSQRARERPHAPAVC
AWDGELTYGRLDELSTKLAHCLIARGVAGTVVPLFFEKSVWMPVAALAVMKAGAASIAMETTQPEERLRGIAAQA
GSPVVLASVQKTSLARGLVSGEVITVGKDQPAPDASNSEMVSLPEVNPSSILYIVFTSGSTGTPKGAIVTHSNFA
SALAYQQQPLGFDTDSRVFDFASFAFDASWYNLVNALTIGGCLCIPSAEERDNNLSGCFEKYRVTTADLTPSVAR
FLGPETLSRLSTLILGGEAVLPSDALLAGNKTEIINVYGPAECTPTITLAPVIKDAKDGVSIGRGAGVCTWVVHP
EDDSCLAPIGAVGELWVEGPLVGLGYLNDADKTAAAFVEDPVWLTRGGRHGRVYRTGDLVRYREDGSLLFVGRKD
TQVKIRGQRIELGEVEHHVLKALSAVAVDQGIDSANAQVVAETIKPDETKGAILVAFIALDSAASTSEEEHASAV
AKLTHGLADRLALTLPSFMMPSAFIPAHGIPVAGTGKTDRRLLRTLGAASWLKHRASADNDKTAEEDMTDLEKQL
LQIWISVLNLQPSEASVNKLFTRLGGDSISAMQVVSQCRLHGLSLTASDVLQSGTVRKLAQRCQALTGGQQKTLV
DNSSEDEASEEPFDLTPIQQMFFDAYPDGLDHYNQSFILDMGQPASVETLRAAMRALVGRHEMLRARYFRDASAG
DRWRQRIIPMDDEDEDDHKISAYAFTYQAVASRDEMAVAAQRRQESLDIRTGPVFACDVFDIAGEQSLVLSAHHL
VIDLVSWRIIWADIEDFVRQGALRGQSTASFRAWSRRQARVGSSLSPLDVLPFPVPAPELGFWALPARENTFGDC
VNLTESIGRDTSSLVLGDANDGLRTEPVDLLVAAAVHSFVRAFPERPPPVVWLEGHGREQSAELTHDVSETVGWF
TTMYPVPVTESAARGSLLDAVRTAKDTRCKVPGKGQPYFACRYHSVAGREAFAGHDIAEITLNFTGRYQQLESDE
SLFGRSEQPAEAERSITEVSESAPRTAMIEINAGVEEGRLGVSFCFHRRMRHQDRLRRWAEDGFGAALSDLALEL
RQTPPRPTLTDLPLLPLSYRGLDELLLHQLPAMGIRPETVANMYPCSPLQEGILLSALKGAATYDTFSVYRCASN
PAVGGVSSSISPARLETAWRRIVARHTILSTIFTLHPEGGSFIQVVVPDAPVRIAHTTPSDPAMTPVAALSGMER
PAFGPGDPRVAFTVCRSDAGDVACRLDLSHTLIDAYSMSLLVQELAAAYDNCEMPPAPAFSDMVRFIESTPKAQR
VSSWTKLLEGVKPCVVPVALPLPGVDVKEEHGDVSLPTTLASAITDFCRDMGITRSVFLQVAWSMALSHFTGMHE
ACFGYLASGRDAPVDKIESLVGPLANLLIGRVDLRRPAREVLEKTLQNTIEHLSMQHASLAEIQHHLGLSGQRLF
NTSLSIREADKLQGTEDRSILMESDVGEDPHEYDLSLSANIDGAKMDIVMEYREPYISSAVAREACVALEKAIEY
LLSVGADETNIEPLFDGFFKRVIGADPASTSAFWKAQFAGIQESNFPPVKTSAVHEGQLDSCVKLDLCGLGWDRT
DCEALVRAAWSMVTARSMGTDETTFGAVVAGDGQKTAPAVVPVRVRLDWEADTEKFIRDIREQAQAMAAFRLTGL
ARIRCMGDEAALACDFKTLLVVRSGDEQQAESGRAILGRGSHAMLVEVQARQNADDARVRIAFDPRTISQSRVSR
VGHQFQHVLRQLASPNQASRLRDISGVSQRDLDDVWTWNSTVPAMVEGRVHDLIEHNAHHRPLAPAIDAWDGTLT
YGQLNDLSTRLAYQLASQGVKRGSVVPLVFEKSMWMPVAALAVMKAGGASVAVDSTQPEERIRVIVSQARTAGRL
IVVSSVANEALVRRLEPDALVTVGLDHLPEPLPECCPTLPIVSPTDVLYIVFTSGSTGRPKGATISHQNFYSAVI
YQRDGLGYRSNSRIFDFASYAFDVAWSNLLNTLTVGACLCIPSAEERENDLPGSIQRYRATIADLTPSVLRSIEP
KSSLSNVSTVILGGEVVLPSDALLVPDNTVVISSYGPAECTPTTTLFHLNPSSEIGIGPAVGLCTWVVDMDNPNV
LAPVGAIGELWLEGPLVGLGYLAEPDKTAAAFIRDPAWLVRGDPGKREGRHGTVYRTGDLVQYKEDGSLLFVGRK
DTQIKIRGQRVELGEIEYHVLQVIKAVEPTASLQIIVEAIQPKGADAKMLVAFVAIDGVKDVTPDEYDDMVRQVT
TGVNDRLAETLPVFMLPTAYIPLQTVPMGPTGKADRRQLRAIGTALSAREISRLSRVEGDRRPPRNDAERTMQAL
WAEVLKVDPASIGIDDSFFRIGGDSIGAMRLVGLARQQGLGVSVRDIFQNPVLRDLAASDHLSNLPN*
Coding >Ophun1|1284
ATGAGGTACCACGTCGACCCAGTCTGCAACGGCAACGGAATCCCCCACGTCAACGGCGAGACGACCCTCAAACAA
GCCGTCAAAGAGACCCTTCCGCGCGGCCTCACCGACATCTGGGCTCGCAATGCCTCGATCCCCGAGACTGTCGAG
GCATGCGTCCACAGCATCTTCAAGAAAATTGCTTGCGAGCAGCCGTCTGCCCCCGCGGTGTGCTCGTGGGATGGC
AACCTCAGCTACGGGGAGCTTGACGCCCTCTCCAGCAGGCTCGCCCACCGACTGGTTCGGCTCGGCGTCGGGCCC
GGCAAGACGGTGCTGCTGAGTTTCGACAAGTCCATGATGATGCCCATTGCCGCGCTGGCCGTTATGAAGGCTGGC
GGCGCGTCCGTGGCACTTGACGTGACGCTCCCAGAGGATCATCTGCGCGTCGTAGCATCTCAGGCGGCCGCCCCC
TTTATTCTCTGCTCAGCCGCCAACGAATCTCTGGCCAGAAACCTCATCAGCTCAGGAAGTGATGATCAAGTCGTC
CTTGTCGTCGTCGACCCTGAGCAGCTCAGCAACCCAGCCAACAAGCAGCAGCAACACGAGCAGCAGCAGGAACTG
CCACTCGTCACCCCTTCCGACGTCCTATACATCGTCTTCACCTCCGGCAGCAAGGGAGCCATGATAACGCACCGC
AACTTTAGCAGCGCCATCGCCTACCAGCAAAAGGCACTCGGCTTCGACGGCAGCTCCCGCGTGTACGACCACGCC
TCATACGCCTCCCACGTGGCGTGGTTCAACCTACTGCATGCCCTAACGTGTGGCGGCTGTCTCTGCATCCCGTCC
GAGCCTGATCGGCGGTCCAATATCGCGGCATCTATTGCCGAACTGGGCGCCACTTACGCTCAGCTGCCGCCCTCT
GTTGCCCGCTCGCTATCCAAGTTTCCATCGTGTCTCCAGCGATTGAACCTCGTGGGCGAGCCGGCAAGCCCCCTC
GAAGCCAGAGAGCACCTGAACCACCACTACCAAGAACACCAGGAACACCATGTGGCTACTGTTAGCGCTTACGGC
CAAGCAGAGACGGCTTCCCTGGCCGCAGTCTGGGCCGCCACTGACGCCAGCCATCCGCTGCCAGCCGGCGTGTGC
GCCTGGATCGTCGACGCCGAAGACCCAAGCTCCCTCGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTCGAGGGC
CCGCTCGTCGGTCCGGGATACCTCAAAGACCCGGACGGGACGGCCGAGGCCTTCATCCAAGATCCGGAATGGCTG
CTTCAAGGTTGCGCGCCCAAGTGGCCCGGCCGCCGCGGACGCGTCCACCGCACCGGCGACCTCGTCCGCTACGAC
GATGCCGGCCAGCTCGTCTTCGTTGGCCATCGCGAGCAGCCGCGTTTGCGTGGAGGTGAACGGATCGATGCAAGC
GTAGTCGAGCACCACCTGCGCCGGGCCGCCGCCTCAGTCCCGGACGAAGACGCCTACGGTCTGCAACTCATCGCC
GAGACAATCCAGCCGCAGGGCGCCGATGACGCCGTCCTCGTTGCCTTCATCGCCCTCGACGGCGCCCGCGACATG
CCGGAGCGGGAGTACGGCGAGGCGGCACAGCGAGTCGCCGCCCGGGTGTCCGAGTGCCTCTCGGCGTCGCCGCTG
CCTCCTCACATGGTGCCCGAGGCCTTCATCCCCATCCAAGCCGTTCCCCTGACAGCCACCGGCAAGGTCGACCGA
CAATGCCTGCGCTCCATCGGTTCGCTTCTCACGGAGTCGGAGATGGCGCGCCTCCGAAGGGACGGCGCCGGCCAG
ACTGAGTTCGAACGGCTCATAGCCGAGCTGTGGGCGCAGACGCTACAGATGCAGCCGTCTTCTTTCGCCCGCGAC
GACGACTTCTTCGCCTCGGGTGGTGATGCAACCGCCGCTCTACGTCTTTGTCGTCTCGCCCGCGAACGGGAGCTC
CCGCTAGAGGCGCGCCAGGTGTTCCGGAGTCCCCGGTTACGTGACATGGCCGCTTGGGCGGCGACACAGAAACCC
TGGGAGCCCACGCCTACCAATGGCATGACGTCTTGTCTCTCGGAAACGTCCTCGTCTTCCCCCTTGGAACCGTCG
TCACCGTCAACTCCGCCGTTCTCGCTGCTGGCTCGTCCCGTGGACGAGGCCGAGGTCAGGGCGCATGCGGCGCGC
CTGTGCCGAGTGCCAGACGCCTCGGTTGTTGACGTGATGCCTTGCACGCCGCTTCAAGCAGGCCTGCTGGCGCTG
ACGGCACAGCAAGATGGCGCCTATGTGGCTCGCAACGTCTTGGAGCTGGGTCCGGATGTTGACATCGGCCGCTTC
CGCGCCAGTTGGGAACAGGTCGTCGCGCTGAACCCTATCCTTCGGACACGCATCGTCAGTCTGCCGCGCCACGGC
GTGGTTCAGGTCGTCCTCGAGGAGGGAGTCCACTGGCACTCGGGATCCGGTGACGCCAACGACTACGTCCTCGAC
AAGGCCTCCCGTCCCATGGGCCTCGGTACGCCGCTGTCACGTTTTGCCCTGTTCGAACGTGGTCGACAGCTCGTG
TGGGAGGTGCATCATGCTCTCTACGACGGCTGGTCGCTGCCGCTGCTCATGCAGGAGGCTGAGCACGTCTACTAC
GACGAGACAAGCCCGCCCTTGGAGCCCATGACGAATCTCATCAAGTACATCTCGGAGCGGGACGAGACCGCCACC
AAGACCTTCTGGCAATCGCAGTTCGCCGGCATCAAAGGGGCCCACTTCCCGGCCCCGCCGAGGTCGGGCGCGACG
TCGTACGAGCCCCACCCCGATTCGCAGATAACCCGGGCCGTGTCGGACCTAAAGTGGGGCCAGGCCGACGTCACT
CCGGCGTCCGTCATCCGGGCCGCCTGGGCCATCATGGTAGCCCACAGCGCCGACTCGGATGAAGCGCTGTTCGGG
CTGACGGTCACGGGCCGGCAGGCGGCGGTGCCTGGAATTGAACGCATGGCCGGGCCAGCCATCGCCACCGTCCCC
GTCCGCGTCGTGCTTAACTGGGACGACAGTGTGAGCCGGTTGCTGGGCTCCGTGCAGAAGCAGGCGGCCGAAATG
ATTCCCTACGAGCAAACGGGTCTGCAGCATATCAGGCGCGTCAGCGAGGCCGCCGCCGTCGCTTGCGGCTTCCAG
TCTCTCCTCGTTATCCAGCCCGGTGGAGGCGGCAGCGGCGCGGACGACTCCTCAGAGACGGCCAACCACCGCATC
TTCCTTAAGGAGCCTGCCGCCGACGATGAAAACCACGTTTCCGAGCAATCGAAGGACTTTGATACCTACGCCGTC
GTTGTCGAATGCCAGCTCGACACCGACGAAGTCCGGCTGCGCATTGGCTTCGACTCCTCCGTCGTTGGCCGCCGG
CAAATGGACCGCATAGTCCGTGGCTTCGAAAGCGTGCTGCGTCTTCTGTGCGCCGAGCAGCATGCCAAGGACAGG
TTGCGAGCCGCCATCGTGCCGAGCCTGTCACAGGCATCAATTGACGACATCTGGCGTTGGAACGCCACTGTCCCG
GCCGCTGTCCACACTTGTATCCACGATCTAGTGTCCCAGAGAGCTCGAGAACGACCTCATGCCCCGGCAGTGTGC
GCGTGGGACGGTGAACTCACCTACGGACGGCTGGATGAGCTCTCCACCAAGCTGGCCCATTGCCTCATCGCCCGC
GGTGTGGCCGGCACCGTCGTCCCGCTCTTCTTCGAAAAATCTGTCTGGATGCCCGTGGCGGCGCTGGCCGTGATG
AAGGCCGGCGCCGCGTCCATCGCCATGGAGACGACGCAGCCCGAAGAGAGGCTCCGAGGCATCGCCGCTCAGGCC
GGCTCGCCCGTTGTGCTGGCGTCGGTGCAAAAGACTTCTCTGGCCCGCGGCCTCGTCTCCGGTGAGGTCATCACT
GTCGGAAAAGATCAGCCTGCTCCGGACGCCTCCAACTCGGAGATGGTGTCGCTTCCTGAAGTCAACCCCTCGAGC
ATCCTGTATATTGTCTTCACGTCCGGTAGCACGGGGACGCCCAAGGGCGCTATTGTCACCCACAGCAACTTTGCC
AGCGCCCTCGCCTACCAGCAGCAGCCGCTTGGCTTCGACACCGACTCGCGCGTCTTTGACTTTGCCTCGTTCGCG
TTCGACGCCTCCTGGTATAACCTCGTGAATGCATTGACCATCGGCGGCTGTCTCTGCATCCCGTCAGCCGAGGAA
CGGGACAACAATCTTAGCGGTTGTTTCGAGAAGTATAGGGTTACTACGGCAGATCTCACGCCCTCGGTGGCGCGC
TTTCTCGGGCCAGAGACGTTGTCGCGCCTATCGACACTCATCCTAGGCGGCGAGGCCGTGCTGCCAAGCGACGCC
CTACTAGCCGGTAACAAGACGGAAATCATCAACGTCTATGGTCCTGCTGAATGCACGCCGACCATCACACTAGCC
CCCGTCATCAAGGACGCCAAGGACGGTGTCAGCATCGGCCGCGGCGCTGGCGTTTGCACTTGGGTTGTTCATCCG
GAGGACGACTCGTGCCTGGCGCCCATCGGAGCCGTTGGCGAGCTCTGGGTCGAAGGGCCCCTCGTCGGACTCGGC
TATCTCAACGACGCGGACAAGACGGCGGCTGCGTTTGTCGAGGATCCCGTGTGGTTGACGCGCGGCGGACGTCAC
GGACGCGTTTACCGAACCGGCGATCTCGTCCGCTATCGTGAAGATGGCTCGCTGCTATTCGTCGGTCGCAAGGAC
ACGCAGGTCAAGATTCGAGGGCAGCGGATCGAGCTCGGCGAGGTCGAGCACCACGTCCTCAAGGCGTTGAGCGCT
GTCGCCGTAGATCAGGGCATCGACTCGGCCAACGCGCAGGTCGTAGCCGAGACGATCAAGCCAGATGAGACAAAG
GGTGCCATTCTTGTGGCCTTTATTGCTCTCGACAGCGCCGCCTCGACATCCGAGGAGGAGCACGCGTCCGCAGTG
GCCAAGCTGACGCACGGATTAGCGGACCGGCTTGCGCTGACGCTGCCGAGTTTCATGATGCCCTCGGCCTTCATC
CCGGCTCACGGAATCCCAGTCGCCGGCACGGGCAAGACGGACAGGCGCCTGCTCCGGACGCTTGGTGCCGCCTCT
TGGCTGAAGCACCGCGCGTCGGCGGACAATGACAAGACGGCGGAAGAGGACATGACGGACCTGGAGAAGCAACTG
CTGCAGATCTGGATCTCCGTCCTCAACCTTCAGCCCTCAGAGGCCTCTGTCAACAAGCTCTTCACCCGACTCGGA
GGCGACTCCATCTCAGCCATGCAGGTCGTCTCGCAGTGCCGGCTGCACGGCCTCTCGCTGACAGCCAGCGACGTG
CTGCAGTCCGGCACGGTCCGCAAGCTGGCGCAGCGGTGCCAGGCACTGACGGGTGGTCAGCAGAAGACGCTCGTC
GACAATAGCAGCGAAGATGAGGCGTCGGAAGAGCCCTTTGACCTGACACCCATCCAGCAAATGTTCTTTGACGCC
TATCCGGACGGGCTGGATCACTACAACCAGAGCTTCATTCTTGATATGGGCCAGCCGGCCTCGGTCGAGACGCTG
CGTGCGGCCATGCGCGCTCTCGTCGGACGCCATGAGATGCTCCGAGCCCGATACTTCCGGGACGCCTCAGCCGGC
GACCGCTGGCGACAGCGTATCATCCCCATGGACGATGAGGACGAAGACGACCACAAGATCTCGGCTTACGCCTTC
ACCTACCAGGCCGTGGCCAGCCGCGACGAGATGGCTGTAGCAGCTCAGCGGCGCCAGGAATCACTCGATATTCGG
ACCGGTCCCGTCTTCGCCTGTGACGTCTTCGACATAGCCGGCGAGCAGTCTCTCGTTCTCTCAGCGCACCACCTC
GTGATTGACCTTGTCTCGTGGCGCATCATCTGGGCCGACATCGAGGATTTCGTTCGGCAGGGAGCACTTCGCGGC
CAATCCACCGCATCGTTCCGCGCCTGGAGCCGGCGACAGGCTCGAGTCGGCTCCAGCCTATCGCCGCTCGACGTC
CTTCCCTTCCCCGTTCCCGCACCGGAGCTCGGCTTCTGGGCGTTGCCAGCGCGGGAAAACACCTTCGGCGACTGC
GTCAACCTCACCGAGTCCATCGGCCGTGATACATCCTCGCTCGTGCTCGGCGACGCAAACGACGGCCTCCGGACC
GAACCCGTCGATCTTCTCGTCGCCGCCGCCGTCCACTCCTTCGTCCGGGCCTTCCCCGAACGTCCACCACCCGTC
GTCTGGCTCGAAGGCCACGGCCGCGAGCAGTCGGCCGAACTGACGCACGACGTGTCCGAGACGGTCGGATGGTTC
ACCACCATGTATCCTGTGCCCGTGACGGAATCCGCAGCCCGGGGCTCGCTTCTCGACGCCGTCCGGACGGCAAAG
GACACACGCTGCAAGGTTCCGGGCAAAGGTCAGCCGTACTTTGCCTGCCGCTATCACAGCGTCGCCGGCCGCGAA
GCCTTTGCAGGCCACGACATTGCCGAGATCACGCTCAACTTTACCGGCCGCTACCAACAGCTCGAGAGTGACGAG
AGTCTCTTCGGTCGCTCCGAGCAGCCGGCCGAGGCGGAGCGCTCCATCACCGAGGTCTCCGAGTCGGCGCCTCGC
ACCGCCATGATCGAGATCAACGCCGGTGTCGAAGAGGGCCGCCTCGGCGTTTCCTTTTGCTTCCACCGCCGCATG
CGCCATCAGGACCGTCTCCGTCGCTGGGCCGAGGACGGCTTCGGCGCCGCCTTGTCGGACCTCGCCCTTGAACTC
CGGCAGACTCCGCCCAGGCCGACGCTGACGGACTTGCCGCTGCTGCCGCTGTCCTACCGCGGCCTGGACGAGTTG
CTGCTCCACCAGCTTCCAGCCATGGGCATCCGGCCCGAGACCGTCGCCAACATGTATCCTTGCTCCCCGCTGCAA
GAGGGCATCCTGCTGAGTGCCCTCAAAGGGGCCGCTACCTACGACACCTTCTCCGTCTACCGCTGCGCCTCTAAC
CCGGCCGTGGGCGGCGTCTCCTCCTCCATCTCGCCCGCCCGGCTCGAGACAGCATGGCGGCGTATCGTGGCTCGT
CATACCATCCTATCAACCATCTTCACCCTGCATCCCGAGGGCGGCAGCTTCATCCAGGTCGTTGTACCCGATGCT
CCGGTCCGCATCGCCCACACGACACCGTCCGATCCGGCCATGACCCCCGTCGCGGCCCTGAGCGGAATGGAACGG
CCGGCATTCGGACCCGGAGACCCGCGCGTCGCTTTCACCGTGTGCCGGTCCGACGCCGGGGACGTAGCTTGCCGT
CTGGACCTCAGTCACACACTCATCGACGCCTACTCCATGTCACTCTTGGTCCAGGAGCTGGCGGCCGCCTATGAC
AACTGCGAGATGCCACCTGCGCCGGCCTTTAGCGACATGGTGCGCTTCATCGAGTCGACGCCCAAAGCCCAGCGT
GTGTCATCGTGGACGAAGCTCCTCGAGGGCGTCAAGCCTTGCGTCGTGCCTGTGGCGCTTCCTCTGCCTGGCGTC
GACGTCAAAGAAGAGCACGGCGACGTCTCGCTGCCAACAACCCTGGCGTCAGCCATCACCGACTTCTGCCGCGAC
ATGGGCATCACCCGCTCCGTCTTCCTCCAGGTGGCCTGGTCCATGGCCCTCTCGCACTTTACCGGCATGCACGAG
GCTTGCTTCGGCTACCTCGCGTCCGGCCGAGACGCGCCCGTGGACAAGATCGAGTCCTTGGTAGGGCCCCTGGCT
AACCTGCTGATCGGCCGCGTCGATCTCCGCCGTCCAGCCCGCGAAGTGCTGGAGAAGACGCTGCAGAACACCATT
GAACACCTCTCTATGCAGCACGCATCGCTCGCCGAAATCCAGCATCATCTCGGCCTGTCCGGCCAGCGGCTTTTC
AACACGTCGCTGTCGATACGCGAGGCCGACAAGCTCCAGGGCACCGAAGACAGGTCCATCCTGATGGAGAGTGAT
GTGGGCGAGGATCCCCACGAGTATGACCTGAGCCTGAGCGCCAACATCGATGGCGCCAAAATGGATATCGTCATG
GAATATCGGGAGCCCTACATCAGCAGTGCTGTTGCTCGAGAAGCCTGCGTGGCGCTCGAAAAGGCCATTGAGTAC
CTGCTGTCGGTGGGCGCCGACGAGACCAACATCGAGCCCCTCTTCGACGGCTTCTTCAAACGCGTTATTGGCGCC
GATCCGGCCTCGACATCGGCCTTCTGGAAAGCCCAGTTCGCCGGCATCCAGGAATCCAACTTCCCGCCCGTCAAG
ACAAGCGCCGTTCACGAAGGCCAGCTCGACAGTTGTGTCAAGCTCGACCTTTGCGGTCTCGGTTGGGACAGAACC
GACTGCGAAGCTCTCGTCCGCGCCGCCTGGTCTATGGTGACGGCCCGCAGCATGGGCACCGATGAGACCACTTTC
GGGGCCGTCGTCGCCGGCGATGGCCAGAAAACGGCCCCGGCCGTGGTACCCGTCCGCGTCCGGTTGGATTGGGAG
GCCGATACGGAGAAGTTTATCAGGGACATCCGCGAACAAGCACAGGCCATGGCAGCGTTCCGGCTCACGGGCCTG
GCACGCATTCGCTGCATGGGCGACGAGGCCGCCTTGGCCTGCGACTTCAAGACACTCCTCGTCGTCCGCAGTGGC
GATGAGCAGCAGGCCGAATCGGGCCGTGCCATTCTGGGTCGGGGATCGCACGCCATGTTAGTCGAGGTTCAGGCT
CGCCAAAATGCCGACGACGCCCGCGTCCGCATCGCCTTTGACCCAAGAACAATCAGCCAGTCTCGCGTCTCCCGA
GTCGGTCATCAGTTCCAGCACGTTCTCCGCCAACTCGCCAGCCCGAACCAGGCCAGCAGGCTGCGTGACATCAGC
GGCGTCAGCCAACGCGATCTCGACGACGTCTGGACTTGGAACTCTACCGTGCCCGCCATGGTTGAGGGTCGTGTG
CACGACCTCATCGAGCACAATGCTCACCATCGACCCTTAGCTCCGGCCATCGACGCCTGGGACGGCACCCTGACG
TACGGCCAGCTGAACGATCTTTCAACAAGGCTGGCCTACCAGCTGGCAAGCCAGGGCGTAAAGCGAGGCTCCGTC
GTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTCGCGGCGCTGGCCGTCATGAAGGCTGGTGGTGCTTCT
GTGGCCGTCGATTCCACACAACCAGAGGAGCGCATCCGGGTCATCGTCTCCCAAGCTCGGACAGCGGGTCGCCTC
ATCGTTGTCAGCTCCGTCGCCAATGAGGCTCTCGTTCGGCGTCTCGAGCCCGACGCTCTCGTCACTGTCGGTCTC
GACCACCTTCCAGAGCCTCTCCCAGAGTGCTGTCCCACGCTTCCGATCGTGAGCCCAACCGATGTCCTCTACATC
GTCTTCACATCGGGCAGCACGGGTCGACCGAAAGGCGCTACCATCTCCCATCAGAACTTCTATAGCGCCGTCATC
TACCAACGGGACGGGCTAGGTTACCGCAGCAATTCTCGCATCTTCGATTTCGCATCGTATGCTTTTGACGTCGCC
TGGTCGAATCTACTAAACACCCTCACGGTGGGCGCTTGCTTATGCATCCCGTCAGCCGAGGAACGCGAAAACGAC
TTGCCCGGCAGCATTCAGAGATACAGAGCAACTATCGCTGATCTCACGCCTTCGGTACTCCGCTCCATTGAGCCC
AAGTCCTCGCTATCAAACGTCTCGACGGTCATCCTCGGAGGTGAAGTCGTCCTTCCTAGTGACGCGCTCCTTGTT
CCCGACAACACTGTTGTGATTAGCAGCTATGGACCGGCTGAGTGCACACCTACAACCACGCTCTTCCACCTCAAC
CCTTCGAGCGAGATTGGTATCGGCCCTGCGGTTGGACTCTGTACCTGGGTGGTCGACATGGACAATCCCAATGTG
CTGGCCCCTGTCGGAGCTATCGGCGAGTTGTGGCTCGAGGGCCCGCTCGTCGGCCTGGGCTACCTCGCCGAGCCT
GACAAGACGGCAGCCGCCTTCATTCGAGATCCGGCCTGGCTGGTCCGCGGTGACCCCGGCAAGCGAGAGGGCCGT
CATGGAACCGTTTACCGCACCGGCGATTTGGTTCAGTACAAAGAAGATGGAAGCCTTCTTTTCGTCGGCCGCAAG
GATACCCAGATCAAGATCAGGGGCCAGCGTGTCGAGCTAGGCGAGATCGAGTACCACGTGCTGCAGGTCATCAAG
GCAGTCGAGCCTACGGCTAGTCTGCAGATCATCGTCGAGGCGATCCAGCCCAAGGGCGCCGACGCCAAGATGCTG
GTTGCCTTTGTGGCCATTGACGGTGTCAAGGACGTGACGCCAGACGAGTACGACGACATGGTCAGACAGGTGACA
ACAGGCGTCAACGACCGACTAGCCGAGACACTGCCAGTCTTCATGTTGCCCACGGCCTATATCCCTCTGCAGACG
GTGCCCATGGGACCGACTGGCAAGGCCGACCGCCGACAGCTTCGAGCCATCGGGACGGCGCTTTCGGCCAGAGAA
ATCTCCCGCCTCAGCCGCGTCGAGGGAGATCGCCGGCCTCCGCGGAACGATGCGGAGCGCACCATGCAGGCGCTG
TGGGCCGAGGTCCTTAAGGTCGATCCGGCAAGCATCGGCATCGACGACAGCTTCTTCCGCATCGGCGGCGATTCC
ATCGGTGCCATGCGCCTCGTGGGCTTGGCTCGTCAACAAGGGCTTGGCGTGTCTGTTCGCGATATCTTCCAAAAC
CCGGTGCTCCGCGATCTTGCAGCTAGCGATCATCTTTCGAATCTTCCAAACTAG
Transcript >Ophun1|1284
ATGAGGTACCACGTCGACCCAGTCTGCAACGGCAACGGAATCCCCCACGTCAACGGCGAGACGACCCTCAAACAA
GCCGTCAAAGAGACCCTTCCGCGCGGCCTCACCGACATCTGGGCTCGCAATGCCTCGATCCCCGAGACTGTCGAG
GCATGCGTCCACAGCATCTTCAAGAAAATTGCTTGCGAGCAGCCGTCTGCCCCCGCGGTGTGCTCGTGGGATGGC
AACCTCAGCTACGGGGAGCTTGACGCCCTCTCCAGCAGGCTCGCCCACCGACTGGTTCGGCTCGGCGTCGGGCCC
GGCAAGACGGTGCTGCTGAGTTTCGACAAGTCCATGATGATGCCCATTGCCGCGCTGGCCGTTATGAAGGCTGGC
GGCGCGTCCGTGGCACTTGACGTGACGCTCCCAGAGGATCATCTGCGCGTCGTAGCATCTCAGGCGGCCGCCCCC
TTTATTCTCTGCTCAGCCGCCAACGAATCTCTGGCCAGAAACCTCATCAGCTCAGGAAGTGATGATCAAGTCGTC
CTTGTCGTCGTCGACCCTGAGCAGCTCAGCAACCCAGCCAACAAGCAGCAGCAACACGAGCAGCAGCAGGAACTG
CCACTCGTCACCCCTTCCGACGTCCTATACATCGTCTTCACCTCCGGCAGCAAGGGAGCCATGATAACGCACCGC
AACTTTAGCAGCGCCATCGCCTACCAGCAAAAGGCACTCGGCTTCGACGGCAGCTCCCGCGTGTACGACCACGCC
TCATACGCCTCCCACGTGGCGTGGTTCAACCTACTGCATGCCCTAACGTGTGGCGGCTGTCTCTGCATCCCGTCC
GAGCCTGATCGGCGGTCCAATATCGCGGCATCTATTGCCGAACTGGGCGCCACTTACGCTCAGCTGCCGCCCTCT
GTTGCCCGCTCGCTATCCAAGTTTCCATCGTGTCTCCAGCGATTGAACCTCGTGGGCGAGCCGGCAAGCCCCCTC
GAAGCCAGAGAGCACCTGAACCACCACTACCAAGAACACCAGGAACACCATGTGGCTACTGTTAGCGCTTACGGC
CAAGCAGAGACGGCTTCCCTGGCCGCAGTCTGGGCCGCCACTGACGCCAGCCATCCGCTGCCAGCCGGCGTGTGC
GCCTGGATCGTCGACGCCGAAGACCCAAGCTCCCTCGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTCGAGGGC
CCGCTCGTCGGTCCGGGATACCTCAAAGACCCGGACGGGACGGCCGAGGCCTTCATCCAAGATCCGGAATGGCTG
CTTCAAGGTTGCGCGCCCAAGTGGCCCGGCCGCCGCGGACGCGTCCACCGCACCGGCGACCTCGTCCGCTACGAC
GATGCCGGCCAGCTCGTCTTCGTTGGCCATCGCGAGCAGCCGCGTTTGCGTGGAGGTGAACGGATCGATGCAAGC
GTAGTCGAGCACCACCTGCGCCGGGCCGCCGCCTCAGTCCCGGACGAAGACGCCTACGGTCTGCAACTCATCGCC
GAGACAATCCAGCCGCAGGGCGCCGATGACGCCGTCCTCGTTGCCTTCATCGCCCTCGACGGCGCCCGCGACATG
CCGGAGCGGGAGTACGGCGAGGCGGCACAGCGAGTCGCCGCCCGGGTGTCCGAGTGCCTCTCGGCGTCGCCGCTG
CCTCCTCACATGGTGCCCGAGGCCTTCATCCCCATCCAAGCCGTTCCCCTGACAGCCACCGGCAAGGTCGACCGA
CAATGCCTGCGCTCCATCGGTTCGCTTCTCACGGAGTCGGAGATGGCGCGCCTCCGAAGGGACGGCGCCGGCCAG
ACTGAGTTCGAACGGCTCATAGCCGAGCTGTGGGCGCAGACGCTACAGATGCAGCCGTCTTCTTTCGCCCGCGAC
GACGACTTCTTCGCCTCGGGTGGTGATGCAACCGCCGCTCTACGTCTTTGTCGTCTCGCCCGCGAACGGGAGCTC
CCGCTAGAGGCGCGCCAGGTGTTCCGGAGTCCCCGGTTACGTGACATGGCCGCTTGGGCGGCGACACAGAAACCC
TGGGAGCCCACGCCTACCAATGGCATGACGTCTTGTCTCTCGGAAACGTCCTCGTCTTCCCCCTTGGAACCGTCG
TCACCGTCAACTCCGCCGTTCTCGCTGCTGGCTCGTCCCGTGGACGAGGCCGAGGTCAGGGCGCATGCGGCGCGC
CTGTGCCGAGTGCCAGACGCCTCGGTTGTTGACGTGATGCCTTGCACGCCGCTTCAAGCAGGCCTGCTGGCGCTG
ACGGCACAGCAAGATGGCGCCTATGTGGCTCGCAACGTCTTGGAGCTGGGTCCGGATGTTGACATCGGCCGCTTC
CGCGCCAGTTGGGAACAGGTCGTCGCGCTGAACCCTATCCTTCGGACACGCATCGTCAGTCTGCCGCGCCACGGC
GTGGTTCAGGTCGTCCTCGAGGAGGGAGTCCACTGGCACTCGGGATCCGGTGACGCCAACGACTACGTCCTCGAC
AAGGCCTCCCGTCCCATGGGCCTCGGTACGCCGCTGTCACGTTTTGCCCTGTTCGAACGTGGTCGACAGCTCGTG
TGGGAGGTGCATCATGCTCTCTACGACGGCTGGTCGCTGCCGCTGCTCATGCAGGAGGCTGAGCACGTCTACTAC
GACGAGACAAGCCCGCCCTTGGAGCCCATGACGAATCTCATCAAGTACATCTCGGAGCGGGACGAGACCGCCACC
AAGACCTTCTGGCAATCGCAGTTCGCCGGCATCAAAGGGGCCCACTTCCCGGCCCCGCCGAGGTCGGGCGCGACG
TCGTACGAGCCCCACCCCGATTCGCAGATAACCCGGGCCGTGTCGGACCTAAAGTGGGGCCAGGCCGACGTCACT
CCGGCGTCCGTCATCCGGGCCGCCTGGGCCATCATGGTAGCCCACAGCGCCGACTCGGATGAAGCGCTGTTCGGG
CTGACGGTCACGGGCCGGCAGGCGGCGGTGCCTGGAATTGAACGCATGGCCGGGCCAGCCATCGCCACCGTCCCC
GTCCGCGTCGTGCTTAACTGGGACGACAGTGTGAGCCGGTTGCTGGGCTCCGTGCAGAAGCAGGCGGCCGAAATG
ATTCCCTACGAGCAAACGGGTCTGCAGCATATCAGGCGCGTCAGCGAGGCCGCCGCCGTCGCTTGCGGCTTCCAG
TCTCTCCTCGTTATCCAGCCCGGTGGAGGCGGCAGCGGCGCGGACGACTCCTCAGAGACGGCCAACCACCGCATC
TTCCTTAAGGAGCCTGCCGCCGACGATGAAAACCACGTTTCCGAGCAATCGAAGGACTTTGATACCTACGCCGTC
GTTGTCGAATGCCAGCTCGACACCGACGAAGTCCGGCTGCGCATTGGCTTCGACTCCTCCGTCGTTGGCCGCCGG
CAAATGGACCGCATAGTCCGTGGCTTCGAAAGCGTGCTGCGTCTTCTGTGCGCCGAGCAGCATGCCAAGGACAGG
TTGCGAGCCGCCATCGTGCCGAGCCTGTCACAGGCATCAATTGACGACATCTGGCGTTGGAACGCCACTGTCCCG
GCCGCTGTCCACACTTGTATCCACGATCTAGTGTCCCAGAGAGCTCGAGAACGACCTCATGCCCCGGCAGTGTGC
GCGTGGGACGGTGAACTCACCTACGGACGGCTGGATGAGCTCTCCACCAAGCTGGCCCATTGCCTCATCGCCCGC
GGTGTGGCCGGCACCGTCGTCCCGCTCTTCTTCGAAAAATCTGTCTGGATGCCCGTGGCGGCGCTGGCCGTGATG
AAGGCCGGCGCCGCGTCCATCGCCATGGAGACGACGCAGCCCGAAGAGAGGCTCCGAGGCATCGCCGCTCAGGCC
GGCTCGCCCGTTGTGCTGGCGTCGGTGCAAAAGACTTCTCTGGCCCGCGGCCTCGTCTCCGGTGAGGTCATCACT
GTCGGAAAAGATCAGCCTGCTCCGGACGCCTCCAACTCGGAGATGGTGTCGCTTCCTGAAGTCAACCCCTCGAGC
ATCCTGTATATTGTCTTCACGTCCGGTAGCACGGGGACGCCCAAGGGCGCTATTGTCACCCACAGCAACTTTGCC
AGCGCCCTCGCCTACCAGCAGCAGCCGCTTGGCTTCGACACCGACTCGCGCGTCTTTGACTTTGCCTCGTTCGCG
TTCGACGCCTCCTGGTATAACCTCGTGAATGCATTGACCATCGGCGGCTGTCTCTGCATCCCGTCAGCCGAGGAA
CGGGACAACAATCTTAGCGGTTGTTTCGAGAAGTATAGGGTTACTACGGCAGATCTCACGCCCTCGGTGGCGCGC
TTTCTCGGGCCAGAGACGTTGTCGCGCCTATCGACACTCATCCTAGGCGGCGAGGCCGTGCTGCCAAGCGACGCC
CTACTAGCCGGTAACAAGACGGAAATCATCAACGTCTATGGTCCTGCTGAATGCACGCCGACCATCACACTAGCC
CCCGTCATCAAGGACGCCAAGGACGGTGTCAGCATCGGCCGCGGCGCTGGCGTTTGCACTTGGGTTGTTCATCCG
GAGGACGACTCGTGCCTGGCGCCCATCGGAGCCGTTGGCGAGCTCTGGGTCGAAGGGCCCCTCGTCGGACTCGGC
TATCTCAACGACGCGGACAAGACGGCGGCTGCGTTTGTCGAGGATCCCGTGTGGTTGACGCGCGGCGGACGTCAC
GGACGCGTTTACCGAACCGGCGATCTCGTCCGCTATCGTGAAGATGGCTCGCTGCTATTCGTCGGTCGCAAGGAC
ACGCAGGTCAAGATTCGAGGGCAGCGGATCGAGCTCGGCGAGGTCGAGCACCACGTCCTCAAGGCGTTGAGCGCT
GTCGCCGTAGATCAGGGCATCGACTCGGCCAACGCGCAGGTCGTAGCCGAGACGATCAAGCCAGATGAGACAAAG
GGTGCCATTCTTGTGGCCTTTATTGCTCTCGACAGCGCCGCCTCGACATCCGAGGAGGAGCACGCGTCCGCAGTG
GCCAAGCTGACGCACGGATTAGCGGACCGGCTTGCGCTGACGCTGCCGAGTTTCATGATGCCCTCGGCCTTCATC
CCGGCTCACGGAATCCCAGTCGCCGGCACGGGCAAGACGGACAGGCGCCTGCTCCGGACGCTTGGTGCCGCCTCT
TGGCTGAAGCACCGCGCGTCGGCGGACAATGACAAGACGGCGGAAGAGGACATGACGGACCTGGAGAAGCAACTG
CTGCAGATCTGGATCTCCGTCCTCAACCTTCAGCCCTCAGAGGCCTCTGTCAACAAGCTCTTCACCCGACTCGGA
GGCGACTCCATCTCAGCCATGCAGGTCGTCTCGCAGTGCCGGCTGCACGGCCTCTCGCTGACAGCCAGCGACGTG
CTGCAGTCCGGCACGGTCCGCAAGCTGGCGCAGCGGTGCCAGGCACTGACGGGTGGTCAGCAGAAGACGCTCGTC
GACAATAGCAGCGAAGATGAGGCGTCGGAAGAGCCCTTTGACCTGACACCCATCCAGCAAATGTTCTTTGACGCC
TATCCGGACGGGCTGGATCACTACAACCAGAGCTTCATTCTTGATATGGGCCAGCCGGCCTCGGTCGAGACGCTG
CGTGCGGCCATGCGCGCTCTCGTCGGACGCCATGAGATGCTCCGAGCCCGATACTTCCGGGACGCCTCAGCCGGC
GACCGCTGGCGACAGCGTATCATCCCCATGGACGATGAGGACGAAGACGACCACAAGATCTCGGCTTACGCCTTC
ACCTACCAGGCCGTGGCCAGCCGCGACGAGATGGCTGTAGCAGCTCAGCGGCGCCAGGAATCACTCGATATTCGG
ACCGGTCCCGTCTTCGCCTGTGACGTCTTCGACATAGCCGGCGAGCAGTCTCTCGTTCTCTCAGCGCACCACCTC
GTGATTGACCTTGTCTCGTGGCGCATCATCTGGGCCGACATCGAGGATTTCGTTCGGCAGGGAGCACTTCGCGGC
CAATCCACCGCATCGTTCCGCGCCTGGAGCCGGCGACAGGCTCGAGTCGGCTCCAGCCTATCGCCGCTCGACGTC
CTTCCCTTCCCCGTTCCCGCACCGGAGCTCGGCTTCTGGGCGTTGCCAGCGCGGGAAAACACCTTCGGCGACTGC
GTCAACCTCACCGAGTCCATCGGCCGTGATACATCCTCGCTCGTGCTCGGCGACGCAAACGACGGCCTCCGGACC
GAACCCGTCGATCTTCTCGTCGCCGCCGCCGTCCACTCCTTCGTCCGGGCCTTCCCCGAACGTCCACCACCCGTC
GTCTGGCTCGAAGGCCACGGCCGCGAGCAGTCGGCCGAACTGACGCACGACGTGTCCGAGACGGTCGGATGGTTC
ACCACCATGTATCCTGTGCCCGTGACGGAATCCGCAGCCCGGGGCTCGCTTCTCGACGCCGTCCGGACGGCAAAG
GACACACGCTGCAAGGTTCCGGGCAAAGGTCAGCCGTACTTTGCCTGCCGCTATCACAGCGTCGCCGGCCGCGAA
GCCTTTGCAGGCCACGACATTGCCGAGATCACGCTCAACTTTACCGGCCGCTACCAACAGCTCGAGAGTGACGAG
AGTCTCTTCGGTCGCTCCGAGCAGCCGGCCGAGGCGGAGCGCTCCATCACCGAGGTCTCCGAGTCGGCGCCTCGC
ACCGCCATGATCGAGATCAACGCCGGTGTCGAAGAGGGCCGCCTCGGCGTTTCCTTTTGCTTCCACCGCCGCATG
CGCCATCAGGACCGTCTCCGTCGCTGGGCCGAGGACGGCTTCGGCGCCGCCTTGTCGGACCTCGCCCTTGAACTC
CGGCAGACTCCGCCCAGGCCGACGCTGACGGACTTGCCGCTGCTGCCGCTGTCCTACCGCGGCCTGGACGAGTTG
CTGCTCCACCAGCTTCCAGCCATGGGCATCCGGCCCGAGACCGTCGCCAACATGTATCCTTGCTCCCCGCTGCAA
GAGGGCATCCTGCTGAGTGCCCTCAAAGGGGCCGCTACCTACGACACCTTCTCCGTCTACCGCTGCGCCTCTAAC
CCGGCCGTGGGCGGCGTCTCCTCCTCCATCTCGCCCGCCCGGCTCGAGACAGCATGGCGGCGTATCGTGGCTCGT
CATACCATCCTATCAACCATCTTCACCCTGCATCCCGAGGGCGGCAGCTTCATCCAGGTCGTTGTACCCGATGCT
CCGGTCCGCATCGCCCACACGACACCGTCCGATCCGGCCATGACCCCCGTCGCGGCCCTGAGCGGAATGGAACGG
CCGGCATTCGGACCCGGAGACCCGCGCGTCGCTTTCACCGTGTGCCGGTCCGACGCCGGGGACGTAGCTTGCCGT
CTGGACCTCAGTCACACACTCATCGACGCCTACTCCATGTCACTCTTGGTCCAGGAGCTGGCGGCCGCCTATGAC
AACTGCGAGATGCCACCTGCGCCGGCCTTTAGCGACATGGTGCGCTTCATCGAGTCGACGCCCAAAGCCCAGCGT
GTGTCATCGTGGACGAAGCTCCTCGAGGGCGTCAAGCCTTGCGTCGTGCCTGTGGCGCTTCCTCTGCCTGGCGTC
GACGTCAAAGAAGAGCACGGCGACGTCTCGCTGCCAACAACCCTGGCGTCAGCCATCACCGACTTCTGCCGCGAC
ATGGGCATCACCCGCTCCGTCTTCCTCCAGGTGGCCTGGTCCATGGCCCTCTCGCACTTTACCGGCATGCACGAG
GCTTGCTTCGGCTACCTCGCGTCCGGCCGAGACGCGCCCGTGGACAAGATCGAGTCCTTGGTAGGGCCCCTGGCT
AACCTGCTGATCGGCCGCGTCGATCTCCGCCGTCCAGCCCGCGAAGTGCTGGAGAAGACGCTGCAGAACACCATT
GAACACCTCTCTATGCAGCACGCATCGCTCGCCGAAATCCAGCATCATCTCGGCCTGTCCGGCCAGCGGCTTTTC
AACACGTCGCTGTCGATACGCGAGGCCGACAAGCTCCAGGGCACCGAAGACAGGTCCATCCTGATGGAGAGTGAT
GTGGGCGAGGATCCCCACGAGTATGACCTGAGCCTGAGCGCCAACATCGATGGCGCCAAAATGGATATCGTCATG
GAATATCGGGAGCCCTACATCAGCAGTGCTGTTGCTCGAGAAGCCTGCGTGGCGCTCGAAAAGGCCATTGAGTAC
CTGCTGTCGGTGGGCGCCGACGAGACCAACATCGAGCCCCTCTTCGACGGCTTCTTCAAACGCGTTATTGGCGCC
GATCCGGCCTCGACATCGGCCTTCTGGAAAGCCCAGTTCGCCGGCATCCAGGAATCCAACTTCCCGCCCGTCAAG
ACAAGCGCCGTTCACGAAGGCCAGCTCGACAGTTGTGTCAAGCTCGACCTTTGCGGTCTCGGTTGGGACAGAACC
GACTGCGAAGCTCTCGTCCGCGCCGCCTGGTCTATGGTGACGGCCCGCAGCATGGGCACCGATGAGACCACTTTC
GGGGCCGTCGTCGCCGGCGATGGCCAGAAAACGGCCCCGGCCGTGGTACCCGTCCGCGTCCGGTTGGATTGGGAG
GCCGATACGGAGAAGTTTATCAGGGACATCCGCGAACAAGCACAGGCCATGGCAGCGTTCCGGCTCACGGGCCTG
GCACGCATTCGCTGCATGGGCGACGAGGCCGCCTTGGCCTGCGACTTCAAGACACTCCTCGTCGTCCGCAGTGGC
GATGAGCAGCAGGCCGAATCGGGCCGTGCCATTCTGGGTCGGGGATCGCACGCCATGTTAGTCGAGGTTCAGGCT
CGCCAAAATGCCGACGACGCCCGCGTCCGCATCGCCTTTGACCCAAGAACAATCAGCCAGTCTCGCGTCTCCCGA
GTCGGTCATCAGTTCCAGCACGTTCTCCGCCAACTCGCCAGCCCGAACCAGGCCAGCAGGCTGCGTGACATCAGC
GGCGTCAGCCAACGCGATCTCGACGACGTCTGGACTTGGAACTCTACCGTGCCCGCCATGGTTGAGGGTCGTGTG
CACGACCTCATCGAGCACAATGCTCACCATCGACCCTTAGCTCCGGCCATCGACGCCTGGGACGGCACCCTGACG
TACGGCCAGCTGAACGATCTTTCAACAAGGCTGGCCTACCAGCTGGCAAGCCAGGGCGTAAAGCGAGGCTCCGTC
GTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTCGCGGCGCTGGCCGTCATGAAGGCTGGTGGTGCTTCT
GTGGCCGTCGATTCCACACAACCAGAGGAGCGCATCCGGGTCATCGTCTCCCAAGCTCGGACAGCGGGTCGCCTC
ATCGTTGTCAGCTCCGTCGCCAATGAGGCTCTCGTTCGGCGTCTCGAGCCCGACGCTCTCGTCACTGTCGGTCTC
GACCACCTTCCAGAGCCTCTCCCAGAGTGCTGTCCCACGCTTCCGATCGTGAGCCCAACCGATGTCCTCTACATC
GTCTTCACATCGGGCAGCACGGGTCGACCGAAAGGCGCTACCATCTCCCATCAGAACTTCTATAGCGCCGTCATC
TACCAACGGGACGGGCTAGGTTACCGCAGCAATTCTCGCATCTTCGATTTCGCATCGTATGCTTTTGACGTCGCC
TGGTCGAATCTACTAAACACCCTCACGGTGGGCGCTTGCTTATGCATCCCGTCAGCCGAGGAACGCGAAAACGAC
TTGCCCGGCAGCATTCAGAGATACAGAGCAACTATCGCTGATCTCACGCCTTCGGTACTCCGCTCCATTGAGCCC
AAGTCCTCGCTATCAAACGTCTCGACGGTCATCCTCGGAGGTGAAGTCGTCCTTCCTAGTGACGCGCTCCTTGTT
CCCGACAACACTGTTGTGATTAGCAGCTATGGACCGGCTGAGTGCACACCTACAACCACGCTCTTCCACCTCAAC
CCTTCGAGCGAGATTGGTATCGGCCCTGCGGTTGGACTCTGTACCTGGGTGGTCGACATGGACAATCCCAATGTG
CTGGCCCCTGTCGGAGCTATCGGCGAGTTGTGGCTCGAGGGCCCGCTCGTCGGCCTGGGCTACCTCGCCGAGCCT
GACAAGACGGCAGCCGCCTTCATTCGAGATCCGGCCTGGCTGGTCCGCGGTGACCCCGGCAAGCGAGAGGGCCGT
CATGGAACCGTTTACCGCACCGGCGATTTGGTTCAGTACAAAGAAGATGGAAGCCTTCTTTTCGTCGGCCGCAAG
GATACCCAGATCAAGATCAGGGGCCAGCGTGTCGAGCTAGGCGAGATCGAGTACCACGTGCTGCAGGTCATCAAG
GCAGTCGAGCCTACGGCTAGTCTGCAGATCATCGTCGAGGCGATCCAGCCCAAGGGCGCCGACGCCAAGATGCTG
GTTGCCTTTGTGGCCATTGACGGTGTCAAGGACGTGACGCCAGACGAGTACGACGACATGGTCAGACAGGTGACA
ACAGGCGTCAACGACCGACTAGCCGAGACACTGCCAGTCTTCATGTTGCCCACGGCCTATATCCCTCTGCAGACG
GTGCCCATGGGACCGACTGGCAAGGCCGACCGCCGACAGCTTCGAGCCATCGGGACGGCGCTTTCGGCCAGAGAA
ATCTCCCGCCTCAGCCGCGTCGAGGGAGATCGCCGGCCTCCGCGGAACGATGCGGAGCGCACCATGCAGGCGCTG
TGGGCCGAGGTCCTTAAGGTCGATCCGGCAAGCATCGGCATCGACGACAGCTTCTTCCGCATCGGCGGCGATTCC
ATCGGTGCCATGCGCCTCGTGGGCTTGGCTCGTCAACAAGGGCTTGGCGTGTCTGTTCGCGATATCTTCCAAAAC
CCGGTGCTCCGCGATCTTGCAGCTAGCGATCATCTTTCGAATCTTCCAAACTAG
Gene >Ophun1|1284
ATGAGGTACCACGTCGACCCAGTCTGCAACGGCAACGGAATCCCCCACGTCAACGGCGAGACGACCCTCAAACAA
GCCGTCAAAGAGACCCTTCCGCGCGGCCTCACCGACATCTGGGCTCGCAATGCCTCGATCCCCGAGACTGTCGAG
GCATGCGTCCACAGCATCTTCAAGAAAATTGCTTGCGAGCAGCCGTCTGCCCCCGCGGTGTGCTCGTGGGATGGC
AACCTCAGCTACGGGGAGCTTGACGCCCTCTCCAGCAGGCTCGCCCACCGACTGGTTCGGCTCGGCGTCGGGCCC
GGCAAGACGGTGCTGCTGAGTTTCGACAAGTCCATGATGATGCCCATTGCCGCGCTGGCCGTTATGAAGGCTGGC
GGCGCGTCCGTGGCACTTGACGTGACGCTCCCAGAGGATCATCTGCGCGTCGTAGCATCTCAGGCGGCCGCCCCC
TTTATTCTCTGCTCAGCCGCCAACGAATCTCTGGCCAGAAACCTCATCAGCTCAGGAAGTGATGATCAAGTCGTC
CTTGTCGTCGTCGACCCTGAGCAGCTCAGCAACCCAGCCAACAAGCAGCAGCAACACGAGCAGCAGCAGGAACTG
CCACTCGTCACCCCTTCCGACGTCCTATACATCGTCTTCACCTCCGGCAGCAAGGGAGCCATGATAACGCACCGC
AACTTTAGCAGCGCCATCGCCTACCAGCAAAAGGCACTCGGCTTCGACGGCAGCTCCCGCGTGTACGACCACGCC
TCATACGCCTCCCACGTGGCGTGGTTCAACCTACTGCATGCCCTAACGTGTGGCGGCTGTCTCTGCATCCCGTCC
GAGCCTGATCGGCGGTCCAATATCGCGGCATCTATTGCCGAACTGGGCGCCACTTACGCTCAGCTGCCGCCCTCT
GTTGCCCGCTCGCTATCCAAGTTTCCATCGTGTCTCCAGCGATTGAACCTCGTGGGCGAGCCGGCAAGCCCCCTC
GAAGCCAGAGAGCACCTGAACCACCACTACCAAGAACACCAGGAACACCATGTGGCTACTGTTAGCGCTTACGGC
CAAGCAGAGACGGCTTCCCTGGCCGCAGTCTGGGCCGCCACTGACGCCAGCCATCCGCTGCCAGCCGGCGTGTGC
GCCTGGATCGTCGACGCCGAAGACCCAAGCTCCCTCGCACCGTTCGGAGCCGAGGGCGAACTCTGGCTCGAGGGC
CCGCTCGTCGGTCCGGGATACCTCAAAGACCCGGACGGGACGGCCGAGGCCTTCATCCAAGATCCGGAATGGCTG
CTTCAAGGTTGCGCGCCCAAGTGGCCCGGCCGCCGCGGACGCGTCCACCGCACCGGCGACCTCGTCCGCTACGAC
GATGCCGGCCAGCTCGTCTTCGTTGGCCATCGCGAGCAGCCGCGTTTGCGTGGAGGTGAACGGATCGATGCAAGC
GTAGTCGAGCACCACCTGCGCCGGGCCGCCGCCTCAGTCCCGGACGAAGACGCCTACGGTCTGCAACTCATCGCC
GAGACAATCCAGCCGCAGGGCGCCGATGACGCCGTCCTCGTTGCCTTCATCGCCCTCGACGGCGCCCGCGACATG
CCGGAGCGGGAGTACGGCGAGGCGGCACAGCGAGTCGCCGCCCGGGTGTCCGAGTGCCTCTCGGCGTCGCCGCTG
CCTCCTCACATGGTGCCCGAGGCCTTCATCCCCATCCAAGCCGTTCCCCTGACAGCCACCGGCAAGGTCGACCGA
CAATGCCTGCGCTCCATCGGTTCGCTTCTCACGGAGTCGGAGATGGCGCGCCTCCGAAGGGACGGCGCCGGCCAG
ACTGAGTTCGAACGGCTCATAGCCGAGCTGTGGGCGCAGACGCTACAGATGCAGCCGTCTTCTTTCGCCCGCGAC
GACGACTTCTTCGCCTCGGGTGGTGATGCAACCGCCGCTCTACGTCTTTGTCGTCTCGCCCGCGAACGGGAGCTC
CCGCTAGAGGCGCGCCAGGTGTTCCGGAGTCCCCGGTTACGTGACATGGCCGCTTGGGCGGCGACACAGAAACCC
TGGGAGCCCACGCCTACCAATGGCATGACGTCTTGTCTCTCGGAAACGTCCTCGTCTTCCCCCTTGGAACCGTCG
TCACCGTCAACTCCGCCGTTCTCGCTGCTGGCTCGTCCCGTGGACGAGGCCGAGGTCAGGGCGCATGCGGCGCGC
CTGTGCCGAGTGCCAGACGCCTCGGTTGTTGACGTGATGCCTTGCACGCCGCTTCAAGCAGGCCTGCTGGCGCTG
ACGGCACAGCAAGATGGCGCCTATGTGGCTCGCAACGTCTTGGAGCTGGGTCCGGATGTTGACATCGGCCGCTTC
CGCGCCAGTTGGGAACAGGTCGTCGCGCTGAACCCTATCCTTCGGACACGCATCGTCAGTCTGCCGCGCCACGGC
GTGGTTCAGGTCGTCCTCGAGGAGGGAGTCCACTGGCACTCGGGATCCGGTGACGCCAACGACTACGTCCTCGAC
AAGGCCTCCCGTCCCATGGGCCTCGGTACGCCGCTGTCACGTTTTGCCCTGTTCGAACGTGGTCGACAGCTCGTG
TGGGAGGTGCATCATGCTCTCTACGACGGCTGGTCGCTGCCGCTGCTCATGCAGGAGGCTGAGCACGTCTACTAC
GACGAGACAAGCCCGCCCTTGGAGCCCATGACGAATCTCATCAAGTACATCTCGGAGCGGGACGAGACCGCCACC
AAGACCTTCTGGCAATCGCAGTTCGCCGGCATCAAAGGGGCCCACTTCCCGGCCCCGCCGAGGTCGGGCGCGACG
TCGTACGAGCCCCACCCCGATTCGCAGATAACCCGGGCCGTGTCGGACCTAAAGTGGGGCCAGGCCGACGTCACT
CCGGCGTCCGTCATCCGGGCCGCCTGGGCCATCATGGTAGCCCACAGCGCCGACTCGGATGAAGCGCTGTTCGGG
CTGACGGTCACGGGCCGGCAGGCGGCGGTGCCTGGAATTGAACGCATGGCCGGGCCAGCCATCGCCACCGTCCCC
GTCCGCGTCGTGCTTAACTGGGACGACAGTGTGAGCCGGTTGCTGGGCTCCGTGCAGAAGCAGGCGGCCGAAATG
ATTCCCTACGAGCAAACGGGTCTGCAGCATATCAGGCGCGTCAGCGAGGCCGCCGCCGTCGCTTGCGGCTTCCAG
TCTCTCCTCGTTATCCAGCCCGGTGGAGGCGGCAGCGGCGCGGACGACTCCTCAGAGACGGCCAACCACCGCATC
TTCCTTAAGGAGCCTGCCGCCGACGATGAAAACCACGTTTCCGAGCAATCGAAGGACTTTGATACCTACGCCGTC
GTTGTCGAATGCCAGCTCGACACCGACGAAGTCCGGCTGCGCATTGGCTTCGACTCCTCCGTCGTTGGCCGCCGG
CAAATGGACCGCATAGTCCGTGGCTTCGAAAGCGTGCTGCGTCTTCTGTGCGCCGAGCAGCATGCCAAGGACAGG
TTGCGAGCCGCCATCGTGCCGAGCCTGTCACAGGCATCAATTGACGACATCTGGCGTTGGAACGCCACTGTCCCG
GCCGCTGTCCACACTTGTATCCACGATCTAGTGTCCCAGAGAGCTCGAGAACGACCTCATGCCCCGGCAGTGTGC
GCGTGGGACGGTGAACTCACCTACGGACGGCTGGATGAGCTCTCCACCAAGCTGGCCCATTGCCTCATCGCCCGC
GGTGTGGCCGGCACCGTCGTCCCGCTCTTCTTCGAAAAATCTGTCTGGATGCCCGTGGCGGCGCTGGCCGTGATG
AAGGCCGGCGCCGCGTCCATCGCCATGGAGACGACGCAGCCCGAAGAGAGGCTCCGAGGCATCGCCGCTCAGGCC
GGCTCGCCCGTTGTGCTGGCGTCGGTGCAAAAGACTTCTCTGGCCCGCGGCCTCGTCTCCGGTGAGGTCATCACT
GTCGGAAAAGATCAGCCTGCTCCGGACGCCTCCAACTCGGAGATGGTGTCGCTTCCTGAAGTCAACCCCTCGAGC
ATCCTGTATATTGTCTTCACGTCCGGTAGCACGGGGACGCCCAAGGGCGCTATTGTCACCCACAGCAACTTTGCC
AGCGCCCTCGCCTACCAGCAGCAGCCGCTTGGCTTCGACACCGACTCGCGCGTCTTTGACTTTGCCTCGTTCGCG
TTCGACGCCTCCTGGTATAACCTCGTGAATGCATTGACCATCGGCGGCTGTCTCTGCATCCCGTCAGCCGAGGAA
CGGGACAACAATCTTAGCGGTTGTTTCGAGAAGTATAGGGTTACTACGGCAGATCTCACGCCCTCGGTGGCGCGC
TTTCTCGGGCCAGAGACGTTGTCGCGCCTATCGACACTCATCCTAGGCGGCGAGGCCGTGCTGCCAAGCGACGCC
CTACTAGCCGGTAACAAGACGGAAATCATCAACGTCTATGGTCCTGCTGAATGCACGCCGACCATCACACTAGCC
CCCGTCATCAAGGACGCCAAGGACGGTGTCAGCATCGGCCGCGGCGCTGGCGTTTGCACTTGGGTTGTTCATCCG
GAGGACGACTCGTGCCTGGCGCCCATCGGAGCCGTTGGCGAGCTCTGGGTCGAAGGGCCCCTCGTCGGACTCGGC
TATCTCAACGACGCGGACAAGACGGCGGCTGCGTTTGTCGAGGATCCCGTGTGGTTGACGCGCGGCGGACGTCAC
GGACGCGTTTACCGAACCGGCGATCTCGTCCGCTATCGTGAAGATGGCTCGCTGCTATTCGTCGGTCGCAAGGAC
ACGCAGGTCAAGATTCGAGGGCAGCGGATCGAGCTCGGCGAGGTCGAGCACCACGTCCTCAAGGCGTTGAGCGCT
GTCGCCGTAGATCAGGGCATCGACTCGGCCAACGCGCAGGTCGTAGCCGAGACGATCAAGCCAGATGAGACAAAG
GGTGCCATTCTTGTGGCCTTTATTGCTCTCGACAGCGCCGCCTCGACATCCGAGGAGGAGCACGCGTCCGCAGTG
GCCAAGCTGACGCACGGATTAGCGGACCGGCTTGCGCTGACGCTGCCGAGTTTCATGATGCCCTCGGCCTTCATC
CCGGCTCACGGAATCCCAGTCGCCGGCACGGGCAAGACGGACAGGCGCCTGCTCCGGACGCTTGGTGCCGCCTCT
TGGCTGAAGCACCGCGCGTCGGCGGACAATGACAAGACGGCGGAAGAGGACATGACGGACCTGGAGAAGCAACTG
CTGCAGATCTGGATCTCCGTCCTCAACCTTCAGCCCTCAGAGGCCTCTGTCAACAAGCTCTTCACCCGACTCGGA
GGCGACTCCATCTCAGCCATGCAGGTCGTCTCGCAGTGCCGGCTGCACGGCCTCTCGCTGACAGCCAGCGACGTG
CTGCAGTCCGGCACGGTCCGCAAGCTGGCGCAGCGGTGCCAGGCACTGACGGGTGGTCAGCAGAAGACGCTCGTC
GACAATAGCAGCGAAGATGAGGCGTCGGAAGAGCCCTTTGACCTGACACCCATCCAGCAAATGTTCTTTGACGCC
TATCCGGACGGGCTGGATCACTACAACCAGAGCTTCATTCTTGATATGGGCCAGCCGGCCTCGGTCGAGACGCTG
CGTGCGGCCATGCGCGCTCTCGTCGGACGCCATGAGATGCTCCGAGCCCGATACTTCCGGGACGCCTCAGCCGGC
GACCGCTGGCGACAGCGTATCATCCCCATGGACGATGAGGACGAAGACGACCACAAGATCTCGGCTTACGCCTTC
ACCTACCAGGCCGTGGCCAGCCGCGACGAGATGGCTGTAGCAGCTCAGCGGCGCCAGGAATCACTCGATATTCGG
ACCGGTCCCGTCTTCGCCTGTGACGTCTTCGACATAGCCGGCGAGCAGTCTCTCGTTCTCTCAGCGCACCACCTC
GTGATTGACCTTGTCTCGTGGCGCATCATCTGGGCCGACATCGAGGATTTCGTTCGGCAGGGAGCACTTCGCGGC
CAATCCACCGCATCGTTCCGCGCCTGGAGCCGGCGACAGGCTCGAGTCGGCTCCAGCCTATCGCCGCTCGACGTC
CTTCCCTTCCCCGTTCCCGCACCGGAGCTCGGCTTCTGGGCGTTGCCAGCGCGGGAAAACACCTTCGGCGACTGC
GTCAACCTCACCGAGTCCATCGGCCGTGATACATCCTCGCTCGTGCTCGGCGACGCAAACGACGGCCTCCGGACC
GAACCCGTCGATCTTCTCGTCGCCGCCGCCGTCCACTCCTTCGTCCGGGCCTTCCCCGAACGTCCACCACCCGTC
GTCTGGCTCGAAGGCCACGGCCGCGAGCAGTCGGCCGAACTGACGCACGACGTGTCCGAGACGGTCGGATGGTTC
ACCACCATGTATCCTGTGCCCGTGACGGAATCCGCAGCCCGGGGCTCGCTTCTCGACGCCGTCCGGACGGCAAAG
GACACACGCTGCAAGGTTCCGGGCAAAGGTCAGCCGTACTTTGCCTGCCGCTATCACAGCGTCGCCGGCCGCGAA
GCCTTTGCAGGCCACGACATTGCCGAGATCACGCTCAACTTTACCGGCCGCTACCAACAGCTCGAGAGTGACGAG
AGTCTCTTCGGTCGCTCCGAGCAGCCGGCCGAGGCGGAGCGCTCCATCACCGAGGTCTCCGAGTCGGCGCCTCGC
ACCGCCATGATCGAGATCAACGCCGGTGTCGAAGAGGGCCGCCTCGGCGTTTCCTTTTGCTTCCACCGCCGCATG
CGCCATCAGGACCGTCTCCGTCGCTGGGCCGAGGACGGCTTCGGCGCCGCCTTGTCGGACCTCGCCCTTGAACTC
CGGCAGACTCCGCCCAGGCCGACGCTGACGGACTTGCCGCTGCTGCCGCTGTCCTACCGCGGCCTGGACGAGTTG
CTGCTCCACCAGCTTCCAGCCATGGGCATCCGGCCCGAGACCGTCGCCAACATGTATCCTTGCTCCCCGCTGCAA
GAGGGCATCCTGCTGAGTGCCCTCAAAGGGGCCGCTACCTACGACACCTTCTCCGTCTACCGCTGCGCCTCTAAC
CCGGCCGTGGGCGGCGTCTCCTCCTCCATCTCGCCCGCCCGGCTCGAGACAGCATGGCGGCGTATCGTGGCTCGT
CATACCATCCTATCAACCATCTTCACCCTGCATCCCGAGGGCGGCAGCTTCATCCAGGTCGTTGTACCCGATGCT
CCGGTCCGCATCGCCCACACGACACCGTCCGATCCGGCCATGACCCCCGTCGCGGCCCTGAGCGGAATGGAACGG
CCGGCATTCGGACCCGGAGACCCGCGCGTCGCTTTCACCGTGTGCCGGTCCGACGCCGGGGACGTAGCTTGCCGT
CTGGACCTCAGTCACACACTCATCGACGCCTACTCCATGTCACTCTTGGTCCAGGAGCTGGCGGCCGCCTATGAC
AACTGCGAGATGCCACCTGCGCCGGCCTTTAGCGACATGGTGCGCTTCATCGAGTCGACGCCCAAAGCCCAGCGT
GTGTCATCGTGGACGAAGCTCCTCGAGGGCGTCAAGCCTTGCGTCGTGCCTGTGGCGCTTCCTCTGCCTGGCGTC
GACGTCAAAGAAGAGCACGGCGACGTCTCGCTGCCAACAACCCTGGCGTCAGCCATCACCGACTTCTGCCGCGAC
ATGGGCATCACCCGCTCCGTCTTCCTCCAGGTGGCCTGGTCCATGGCCCTCTCGCACTTTACCGGCATGCACGAG
GCTTGCTTCGGCTACCTCGCGTCCGGCCGAGACGCGCCCGTGGACAAGATCGAGTCCTTGGTAGGGCCCCTGGCT
AACCTGCTGATCGGCCGCGTCGATCTCCGCCGTCCAGCCCGCGAAGTGCTGGAGAAGACGCTGCAGAACACCATT
GAACACCTCTCTATGCAGCACGCATCGCTCGCCGAAATCCAGCATCATCTCGGCCTGTCCGGCCAGCGGCTTTTC
AACACGTCGCTGTCGATACGCGAGGCCGACAAGCTCCAGGGCACCGAAGACAGGTCCATCCTGATGGAGAGTGAT
GTGGGCGAGGATCCCCACGAGGTAGGCAGACGCTCTCTCTCTTGCTGCTTTCTTTTTCCCTCTCTTCTTACCTCT
TGGCTTTGTTCATCGGGCTGACGATGGCGACAGTATGACCTGAGCCTGAGCGCCAACATCGATGGCGCCAAAATG
GATATCGTCATGGAATATCGGGAGCCCTACATCAGCAGTGCTGTTGCTCGAGAAGCCTGCGTGGCGCTCGAAAAG
GCCATTGAGTACCTGCTGTCGGTGGGCGCCGACGAGACCAACATCGAGCCCCTCTTCGACGGCTTCTTCAAACGC
GTTATTGGCGCCGATCCGGCCTCGACATCGGCCTTCTGGAAAGCCCAGTTCGCCGGCATCCAGGAATCCAACTTC
CCGCCCGTCAAGACAAGCGCCGTTCACGAAGGCCAGCTCGACAGTTGTGTCAAGCTCGACCTTTGCGGTCTCGGT
TGGGACAGAACCGACTGCGAAGCTCTCGTCCGCGCCGCCTGGTCTATGGTGACGGCCCGCAGCATGGGCACCGAT
GAGACCACTTTCGGGGCCGTCGTCGCCGGCGATGGCCAGAAAACGGCCCCGGCCGTGGTACCCGTCCGCGTCCGG
TTGGATTGGGAGGCCGATACGGAGAAGTTTATCAGGGACATCCGCGAACAAGCACAGGCCATGGCAGCGTTCCGG
CTCACGGGCCTGGCACGCATTCGCTGCATGGGCGACGAGGCCGCCTTGGCCTGCGACTTCAAGACACTCCTCGTC
GTCCGCAGTGGCGATGAGCAGCAGGCCGAATCGGGCCGTGCCATTCTGGGTCGGGGATCGCACGCCATGTTAGTC
GAGGTTCAGGCTCGCCAAAATGCCGACGACGCCCGCGTCCGCATCGCCTTTGACCCAAGAACAATCAGCCAGTCT
CGCGTCTCCCGAGTCGGTCATCAGTTCCAGCACGTTCTCCGCCAACTCGCCAGCCCGAACCAGGCCAGCAGGCTG
CGTGACATCAGCGGCGTCAGCCAACGCGATCTCGACGACGTCTGGACTTGGAACTCTACCGTGCCCGCCATGGTT
GAGGGTCGTGTGCACGACCTCATCGAGCACAATGCTCACCATCGACCCTTAGCTCCGGCCATCGACGCCTGGGAC
GGCACCCTGACGTACGGCCAGCTGAACGATCTTTCAACAAGGCTGGCCTACCAGCTGGCAAGCCAGGGCGTAAAG
CGAGGCTCCGTCGTGCCCCTCGTCTTCGAAAAGTCCATGTGGATGCCCGTCGCGGCGCTGGCCGTCATGAAGGCT
GGTGGTGCTTCTGTGGCCGTCGATTCCACACAACCAGAGGAGCGCATCCGGGTCATCGTCTCCCAAGCTCGGACA
GCGGGTCGCCTCATCGTTGTCAGCTCCGTCGCCAATGAGGCTCTCGTTCGGCGTCTCGAGCCCGACGCTCTCGTC
ACTGTCGGTCTCGACCACCTTCCAGAGCCTCTCCCAGAGTGCTGTCCCACGCTTCCGATCGTGAGCCCAACCGAT
GTCCTCTACATCGTCTTCACATCGGGCAGCACGGGTCGACCGAAAGGCGCTACCATCTCCCATCAGAACTTCTAT
AGCGCCGTCATCTACCAACGGGACGGGCTAGGTTACCGCAGCAATTCTCGCATCTTCGATTTCGCATCGTATGCT
TTTGACGTCGCCTGGTCGAATCTACTAAACACCCTCACGGTGGGCGCTTGCTTATGCATCCCGTCAGCCGAGGAA
CGCGAAAACGACTTGCCCGGCAGCATTCAGAGATACAGAGCAACTATCGCTGATCTCACGCCTTCGGTACTCCGC
TCCATTGAGCCCAAGTCCTCGCTATCAAACGTCTCGACGGTCATCCTCGGAGGTGAAGTCGTCCTTCCTAGTGAC
GCGCTCCTTGTTCCCGACAACACTGTTGTGATTAGCAGCTATGGACCGGCTGAGTGCACACCTACAACCACGCTC
TTCCACCTCAACCCTTCGAGCGAGATTGGTATCGGCCCTGCGGTTGGACTCTGTACCTGGGTGGTCGACATGGAC
AATCCCAATGTGCTGGCCCCTGTCGGAGCTATCGGCGAGTTGTGGCTCGAGGGCCCGCTCGTCGGCCTGGGCTAC
CTCGCCGAGCCTGACAAGACGGCAGCCGCCTTCATTCGAGATCCGGCCTGGCTGGTCCGCGGTGACCCCGGCAAG
CGAGAGGGCCGTCATGGAACCGTTTACCGCACCGGCGATTTGGTTCAGTACAAAGAAGATGGAAGCCTTCTTTTC
GTCGGCCGCAAGGATACCCAGATCAAGATCAGGGGCCAGCGTGTCGAGCTAGGCGAGATCGAGTACCACGTGCTG
CAGGTCATCAAGGCAGTCGAGCCTACGGCTAGTCTGCAGATCATCGTCGAGGCGATCCAGCCCAAGGGCGCCGAC
GCCAAGATGCTGGTTGCCTTTGTGGCCATTGACGGTGTCAAGGACGTGACGCCAGACGAGTACGACGACATGGTC
AGACAGGTGACAACAGGCGTCAACGACCGACTAGCCGAGACACTGCCAGTCTTCATGTTGCCCACGGCCTATATC
CCTCTGCAGACGGTGCCCATGGGACCGACTGGCAAGGCCGACCGCCGACAGCTTCGAGCCATCGGGACGGCGCTT
TCGGCCAGAGAAATCTCCCGCCTCAGCCGCGTCGAGGGAGATCGCCGGCCTCCGCGGAACGATGCGGAGCGCACC
ATGCAGGCGCTGTGGGCCGAGGTCCTTAAGGTCGATCCGGCAAGCATCGGCATCGACGACAGCTTCTTCCGCATC
GGCGGCGATTCCATCGGTGCCATGCGCCTCGTGGGCTTGGCTCGTCAACAAGGGCTTGGCGTGTCTGTTCGCGAT
ATCTTCCAAAACCCGGTGCTCCGCGATCTTGCAGCTAGCGATCATCTTTCGAATCTTCCAAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail