Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|1283
Gene name
LocationContig_15:70202..71723
Strand+
Gene length (bp)1521
Transcript length (bp)1473
Coding sequence length (bp)1473
Protein length (aa) 491

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02458 Transferase Transferase family 1.8E-07 145 372

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup296
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|00022
Ophiocordyceps camponoti-floridani Ophcf2|01596
Ophiocordyceps camponoti-floridani Ophcf2|06712
Ophiocordyceps camponoti-rufipedis Ophun1|1283 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2810
Ophiocordyceps camponoti-rufipedis Ophun1|950
Ophiocordyceps kimflemingae Ophio5|2947
Ophiocordyceps kimflemingae Ophio5|4080
Ophiocordyceps kimflemingae Ophio5|6414
Ophiocordyceps subramaniannii Hirsu2|9518

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|1283
MKTAAESPPTEDDVYPVHLLDGTKLFRSLLVCYVFRFNHVLDAQKLHASLSTLLEIGDWRKLGGRLRLKEDGRLE
IHVPRPFTLQRPAVLFTHQKLDSSIETHPAGRHLAKPSNSCSSNRHNQSQIEAFAQRPDSPRSVKDLIEKEMPQL
SLHVTSFNDATVIALLWPHTLMDAAGLNLLLTKWSLVLHGKGQDVSPVACARQDMLEQAELQSHEEREEPVVNRL
RPGLFGLIVMVARIVWHKMCRTTYETRTIMLSGHDVLQLRQLAERDISSQLEKEDGKALVSESDVLAAWGAKLAA
SSQQKSRPITIYSYINARFRLPFFRSTPDKECIQNMILIAYASLSAQTATEPLGRLALSHRRQVAEQSTTQQTLA
YFAMQRKHAKSHQTTRVLFGDPSANTLNFNNLTKFDLFRAMDFSPAVAAGQQDTAGGNPPGTVVVFYPLVLNDTP
SMDMLCVLGKDDADNCLMVGSFLPRTWVKIEMELQRLQSS*
Coding >Ophun1|1283
ATGAAAACGGCCGCAGAGTCACCGCCAACGGAGGATGACGTCTACCCCGTGCACCTCTTAGACGGTACCAAGCTT
TTCCGCAGCCTTCTCGTGTGCTACGTCTTCCGATTCAATCATGTTCTCGACGCGCAGAAACTGCACGCTTCTCTC
TCCACCTTGCTGGAAATCGGGGACTGGAGGAAGCTCGGTGGCCGGCTGAGACTCAAGGAAGACGGAAGGCTCGAG
ATTCATGTTCCGAGGCCCTTCACTCTCCAGCGACCAGCCGTCCTCTTCACTCACCAGAAGCTGGACAGCAGTATC
GAGACGCATCCAGCAGGACGACATCTCGCCAAGCCATCAAACAGCTGTTCATCAAACCGACACAACCAGTCTCAA
ATTGAGGCATTTGCACAAAGACCAGACTCGCCACGGTCGGTAAAGGACCTCATTGAAAAGGAAATGCCGCAGTTA
TCTCTCCACGTCACTTCCTTCAACGACGCCACCGTCATTGCCCTCTTATGGCCTCATACCCTCATGGACGCAGCG
GGCTTAAACCTGCTACTCACCAAGTGGTCTCTCGTTCTGCACGGCAAGGGGCAAGACGTCTCGCCAGTAGCATGT
GCACGACAAGATATGCTGGAACAGGCAGAGCTGCAGAGCCACGAGGAAAGAGAAGAGCCGGTGGTCAACAGGCTA
CGTCCCGGTCTCTTTGGGCTCATTGTCATGGTGGCGCGCATTGTCTGGCACAAGATGTGCAGGACTACTTACGAG
ACGCGGACAATCATGCTGTCGGGACACGATGTCCTTCAGCTGCGACAACTGGCCGAGCGAGACATCTCCAGTCAA
CTAGAAAAAGAAGATGGTAAAGCTTTGGTCAGCGAGTCGGATGTGCTCGCGGCCTGGGGGGCAAAGCTGGCAGCT
TCGTCTCAACAAAAATCACGGCCGATAACTATATACAGTTACATCAACGCCCGCTTCCGACTCCCCTTCTTTCGA
TCGACACCCGACAAGGAATGTATCCAGAACATGATACTGATCGCATATGCCTCGCTCTCCGCCCAAACTGCAACC
GAACCTCTGGGCCGGCTTGCCCTCTCCCATCGACGACAAGTAGCTGAGCAGTCGACAACGCAGCAAACACTCGCC
TACTTCGCCATGCAACGCAAGCATGCCAAGTCCCACCAGACGACCAGGGTATTATTCGGCGACCCGTCGGCGAAC
ACGCTCAACTTCAACAACCTAACCAAATTCGACCTCTTCCGCGCCATGGACTTTTCCCCCGCCGTTGCAGCTGGA
CAGCAAGATACCGCGGGAGGGAATCCTCCGGGAACCGTGGTGGTCTTTTACCCTCTGGTGCTCAACGACACGCCA
TCTATGGACATGTTGTGCGTGCTTGGTAAGGATGATGCAGATAATTGCTTGATGGTTGGGTCGTTTCTGCCGCGC
ACATGGGTCAAGATTGAGATGGAGTTGCAAAGATTGCAGTCATCATGA
Transcript >Ophun1|1283
ATGAAAACGGCCGCAGAGTCACCGCCAACGGAGGATGACGTCTACCCCGTGCACCTCTTAGACGGTACCAAGCTT
TTCCGCAGCCTTCTCGTGTGCTACGTCTTCCGATTCAATCATGTTCTCGACGCGCAGAAACTGCACGCTTCTCTC
TCCACCTTGCTGGAAATCGGGGACTGGAGGAAGCTCGGTGGCCGGCTGAGACTCAAGGAAGACGGAAGGCTCGAG
ATTCATGTTCCGAGGCCCTTCACTCTCCAGCGACCAGCCGTCCTCTTCACTCACCAGAAGCTGGACAGCAGTATC
GAGACGCATCCAGCAGGACGACATCTCGCCAAGCCATCAAACAGCTGTTCATCAAACCGACACAACCAGTCTCAA
ATTGAGGCATTTGCACAAAGACCAGACTCGCCACGGTCGGTAAAGGACCTCATTGAAAAGGAAATGCCGCAGTTA
TCTCTCCACGTCACTTCCTTCAACGACGCCACCGTCATTGCCCTCTTATGGCCTCATACCCTCATGGACGCAGCG
GGCTTAAACCTGCTACTCACCAAGTGGTCTCTCGTTCTGCACGGCAAGGGGCAAGACGTCTCGCCAGTAGCATGT
GCACGACAAGATATGCTGGAACAGGCAGAGCTGCAGAGCCACGAGGAAAGAGAAGAGCCGGTGGTCAACAGGCTA
CGTCCCGGTCTCTTTGGGCTCATTGTCATGGTGGCGCGCATTGTCTGGCACAAGATGTGCAGGACTACTTACGAG
ACGCGGACAATCATGCTGTCGGGACACGATGTCCTTCAGCTGCGACAACTGGCCGAGCGAGACATCTCCAGTCAA
CTAGAAAAAGAAGATGGTAAAGCTTTGGTCAGCGAGTCGGATGTGCTCGCGGCCTGGGGGGCAAAGCTGGCAGCT
TCGTCTCAACAAAAATCACGGCCGATAACTATATACAGTTACATCAACGCCCGCTTCCGACTCCCCTTCTTTCGA
TCGACACCCGACAAGGAATGTATCCAGAACATGATACTGATCGCATATGCCTCGCTCTCCGCCCAAACTGCAACC
GAACCTCTGGGCCGGCTTGCCCTCTCCCATCGACGACAAGTAGCTGAGCAGTCGACAACGCAGCAAACACTCGCC
TACTTCGCCATGCAACGCAAGCATGCCAAGTCCCACCAGACGACCAGGGTATTATTCGGCGACCCGTCGGCGAAC
ACGCTCAACTTCAACAACCTAACCAAATTCGACCTCTTCCGCGCCATGGACTTTTCCCCCGCCGTTGCAGCTGGA
CAGCAAGATACCGCGGGAGGGAATCCTCCGGGAACCGTGGTGGTCTTTTACCCTCTGGTGCTCAACGACACGCCA
TCTATGGACATGTTGTGCGTGCTTGGTAAGGATGATGCAGATAATTGCTTGATGGTTGGGTCGTTTCTGCCGCGC
ACATGGGTCAAGATTGAGATGGAGTTGCAAAGATTGCAGTCATCATGA
Gene >Ophun1|1283
ATGAAAACGGCCGCAGAGTCACCGCCAACGGAGGATGACGTCTACCCCGTGCACCTCTTAGACGGTACCAAGCTT
TTCCGCAGCCTTCTCGTGTGCTACGTCTTCCGATTCAATCATGTTCTCGACGCGCAGAAACTGCACGCTTCTCTC
TCCACCTTGCTGGAAATCGGGGACTGGAGGAAGCTCGGTGGCCGGCTGAGACTCAAGGTAAGCCTAGCAGAGTCG
AGGGCAAAGACAGCACTGACTACAAGACAGGAAGACGGAAGGCTCGAGATTCATGTTCCGAGGCCCTTCACTCTC
CAGCGACCAGCCGTCCTCTTCACTCACCAGAAGCTGGACAGCAGTATCGAGACGCATCCAGCAGGACGACATCTC
GCCAAGCCATCAAACAGCTGTTCATCAAACCGACACAACCAGTCTCAAATTGAGGCATTTGCACAAAGACCAGAC
TCGCCACGGTCGGTAAAGGACCTCATTGAAAAGGAAATGCCGCAGTTATCTCTCCACGTCACTTCCTTCAACGAC
GCCACCGTCATTGCCCTCTTATGGCCTCATACCCTCATGGACGCAGCGGGCTTAAACCTGCTACTCACCAAGTGG
TCTCTCGTTCTGCACGGCAAGGGGCAAGACGTCTCGCCAGTAGCATGTGCACGACAAGATATGCTGGAACAGGCA
GAGCTGCAGAGCCACGAGGAAAGAGAAGAGCCGGTGGTCAACAGGCTACGTCCCGGTCTCTTTGGGCTCATTGTC
ATGGTGGCGCGCATTGTCTGGCACAAGATGTGCAGGACTACTTACGAGACGCGGACAATCATGCTGTCGGGACAC
GATGTCCTTCAGCTGCGACAACTGGCCGAGCGAGACATCTCCAGTCAACTAGAAAAAGAAGATGGTAAAGCTTTG
GTCAGCGAGTCGGATGTGCTCGCGGCCTGGGGGGCAAAGCTGGCAGCTTCGTCTCAACAAAAATCACGGCCGATA
ACTATATACAGTTACATCAACGCCCGCTTCCGACTCCCCTTCTTTCGATCGACACCCGACAAGGAATGTATCCAG
AACATGATACTGATCGCATATGCCTCGCTCTCCGCCCAAACTGCAACCGAACCTCTGGGCCGGCTTGCCCTCTCC
CATCGACGACAAGTAGCTGAGCAGTCGACAACGCAGCAAACACTCGCCTACTTCGCCATGCAACGCAAGCATGCC
AAGTCCCACCAGACGACCAGGGTATTATTCGGCGACCCGTCGGCGAACACGCTCAACTTCAACAACCTAACCAAA
TTCGACCTCTTCCGCGCCATGGACTTTTCCCCCGCCGTTGCAGCTGGACAGCAAGATACCGCGGGAGGGAATCCT
CCGGGAACCGTGGTGGTCTTTTACCCTCTGGTGCTCAACGACACGCCATCTATGGACATGTTGTGCGTGCTTGGT
AAGGATGATGCAGATAATTGCTTGATGGTTGGGTCGTTTCTGCCGCGCACATGGGTCAAGATTGAGATGGAGTTG
CAAAGATTGCAGTCATCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail